GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-23 11:50:46, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_066311661            1804 bp    mRNA    linear   PLN 10-JUL-2024
DEFINITION  PREDICTED: Oryza sativa Japonica Group uncharacterized protein
            (LOC9270848), transcript variant X4, mRNA.
ACCESSION   XM_066311661
VERSION     XM_066311661.1
DBLINK      BioProject: PRJNA1123306
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089035) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034140825.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1804
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="1"
     gene            1..1804
                     /gene="LOC9270848"
                     /note="uncharacterized LOC9270848; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4 long
                     SRA reads, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 72 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:9270848"
     misc_feature    1
                     /gene="LOC9270848"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             1224..1616
                     /gene="LOC9270848"
                     /codon_start=1
                     /product="uncharacterized protein isoform X4"
                     /protein_id="XP_066167758.1"
                     /db_xref="GeneID:9270848"
                     /translation="
MNFGADTSRELGARSSEKAARWIRTMESALKPPRKDELVSCSHTRWQAFRWDAAHARAFKLQENNDAYMLSRCSNRMHSIGWTVFSSVHNDPMASDVIAPSPWTIFDCKNGFRLFTEAKDGGSEGKVILV"
ORIGIN      
gtctctctctcaccctctccctccgctctctcgccgccgtcgccgccacgcgctgccacctccgtctccccctcgcgccaccgcgtctactgccgccgccgccgccgcgtccaccgcagccgcctcgggcgggtccacctctcctccaccgccgcgtccacttccgccgccgtcgccgcgtccaccgcagccgccttcgccgcgtccacctccgccgccgccgcgtccaccgcagccgcctcggtcgcgtccacctctgctgccgccgcatccatttccgccgccgctgccgcgacgctgtctccgagcgccgtcgccatcatcgaggcgagcagccatctcgagcgccgccgctgccaagtgcctcctccggccgccggcgtccggatccggactccatgtggtcgggagacgtcgatctgaccggcggatgtgacgaggagctcggccgcgccacacggagctcaacctcggcggattgggcgacggcgtcggcctcggcggtgaaaagtctctgttgctgctgccgccgtcgggcagtcaaggtttttcctgccggtagagtatggaaaaagaatcttccatgtgctagggcaaggaagccttttgtagtcagctctctagacttgcttatgcttctgcagtgagcacccagcaataggtaaatctgctctcttggttctctgaattaaaaggacatacaactatagcatgatgatcttgcaggaaattatcatgtcttttcagcaagattgctctatatgaatcgagttgtcgaaaaaggtgccatttagtccacgggcttcacgaaaatcagtgtttcaaagaaacaaaccttgaaacattccatggggttctcagatcgcggatggcggcggccaccaggcggatgtggtcaagggaggactggcagcgctgagcaacgacgtctaggaatagcatctcaggtcagtcctcttgctccctcatctcgctccttacatatttctggattattcagttgaggagaaggaattcacaaaggaactgctcctgcacccactccccaatcgcaacgcgctggcccacttccactcctctgcgcatccctctgctgccaacggacgctagcaacatgtcaaaccccaaggccatcccccagctgtgcaagtcactgactttacggtattggagttcgagtagaagatcagctgctccgtcatcgacgatggcctgatccacagatgaattttggtgctgatacttccagggagttgggtgctcgaagttcagaaaaagctgctaggtggatcaggacaatggaatctgccttaaagcccccaagaaaggatgaacttgttagctgttcacatacaagatggcaagcttttagatgggatgcagcacatgctcgtgctttcaagttacaagagaacaatgatgcctatatgctaagccgctgcagtaaccgcatgcactcaataggttggactgtattttcttctgtccataacgatcctatggcatctgatgttattgcaccttctccatggacaatatttgactgtaaaaatggattccgtttgtttactgaggcaaaagatggtggttcagaggggaaggtaattcttgtatgaaacaaaggttgcatatccttcttatgacgattctagcaaggtcggtattgccatgggtgccttggagcttaatcatttgcctgattctcagcatgcttgtctgaaaagcagattgacctgagtttgtgtggtaagtggaggtgtccctgcaaagtgaagtcctcggtttattccagcttccattacat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]