LOCUS       XM_026022032             694 bp    mRNA    linear   PLN 10-JUL-2024
DEFINITION  PREDICTED: Oryza sativa Japonica Group auxin-binding protein 4
            (LOC107277066), mRNA.
ACCESSION   XM_026022032
VERSION     XM_026022032.2
DBLINK      BioProject: PRJNA1123306
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089046) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jul 10, 2024 this sequence version replaced XM_026022032.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034140825.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..694
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="12"
     gene            1..694
                     /gene="LOC107277066"
                     /note="auxin-binding protein 4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4 long
                     SRA reads, 34 Proteins, and 62% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:107277066"
     CDS             164..655
                     /gene="LOC107277066"
                     /codon_start=1
                     /product="auxin-binding protein 4"
                     /protein_id="XP_025877817.1"
                     /db_xref="GeneID:107277066"
                     /translation="

MCHQSWLERVLTVSGVCSDNSVVKDIRQMPQGTLAHGMKEVEVCLQTFGPGQRTPIHRHSCEEVFVVLKGKGTLFLGSSSMKYPGQPQEIPVFQNSTFTIPVNDPHQVWNSDEHEDLQVIVVISRPPIKVFFYDDWNMPHTAAKLQFPIFWDEECLIAPKDEL"

     misc_feature    224..631
                     /gene="LOC107277066"
                     /note="auxin-binding protein 1, cupin domain; Region:
                     cupin_ABP1; cd02220"
                     /db_xref="CDD:380349"
     misc_feature    order(227..241,275..286,290..292,347..349,353..355,
                     359..361,383..385,389..391,431..433,437..442,446..460,
                     521..523,527..529,533..538)
                     /gene="LOC107277066"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:380349"
     misc_feature    order(293..295,299..301,323..328,332..334,338..340,
                     350..352,356..358,479..481,614..616)
                     /gene="LOC107277066"
                     /note="active site"
                     /db_xref="CDD:380349"
ORIGIN      

ttctgaattctgatgtgaagtgaacttttcttctgaattctgatgcgaacggaggtaattctgatgtgaacggaggaaatcgcatggaccaaccatagaagcagattccagctgctcagccgcttccctcccctcctgccagcgagttccagcaagtctgcagatgtgccaccaatcttggcttgagcgagtgctaactgtatctggtgtatgttcagacaattcagtggtgaaagacattagacaaatgccccaaggcacgctagctcatggaatgaaggaggtggaagtgtgccttcagacatttggtccaggccaaaggacacccatccacaggcactcatgtgaggaagtttttgttgtgttgaaagggaaaggcacactctttctgggatcaagctcaatgaagtaccctggccagcctcaggagatccctgtctttcagaacagcacatttactatccctgtaaatgatcctcaccaggtttggaattctgatgagcatgaggatttgcaggttattgtggtcatatcgcgcccgcctatcaaagtgtttttctacgatgactggaatatgcctcacacggctgcaaaactgcagttccccatcttctgggacgaggaatgcttaattgcacctaaagatgaactctaggctataaactgcatattgttgttgtcatctttgttcaag

//