GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-23 11:44:15, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_015785310             714 bp    mRNA    linear   PLN 10-JUL-2024
DEFINITION  PREDICTED: Oryza sativa Japonica Group thioredoxin H-type
            (LOC4339267), mRNA.
ACCESSION   XM_015785310
VERSION     XM_015785310.3
DBLINK      BioProject: PRJNA1123306
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089039) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jul 10, 2024 this sequence version replaced XM_015785310.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034140825.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="5"
     gene            1..714
                     /gene="LOC4339267"
                     /note="thioredoxin H-type; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     mRNAs, 296 ESTs, 8679 long SRA reads, 21 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 179 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:4339267"
     misc_feature    1
                     /gene="LOC4339267"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             146..511
                     /gene="LOC4339267"
                     /codon_start=1
                     /product="thioredoxin H-type"
                     /protein_id="XP_015640796.1"
                     /db_xref="GeneID:4339267"
                     /translation="
MAAASAAAQAEGTVIAIHSLDEWTIQIEEANSAKKLVVIDFTASWCGPCRIIAPVFADLAKKHTNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAMKDELASKLELHMAM"
     misc_feature    221..493
                     /gene="LOC4339267"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(281..283,290..292)
                     /gene="LOC4339267"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     polyA_site      714
                     /gene="LOC4339267"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
atctttgggaaggcgagccatggccaaggggagcacatagtcagaacaccgcagagcaagtgtgtgtcctgcctcgcgtgaaagataagcggcgctctgctctgctcgccgaggagagagagaagagagagagagagagctagagatggcggcggcctcagcggcggcgcaggcggagggaacggtgatcgcgatccacagcctcgacgagtggaccatccagatcgaggaggccaacagcgccaagaagctggttgtgattgacttcactgcatcatggtgcggaccatgccgcatcattgctccagtttttgccgatctagcaaagaagcacacaaatgctgtttttctgaaggttgacgtcgatgaactgaagcctattgctgagcaattcagtgttgaggctatgccaacattcctgtttatgaaggagggagatgttaaagacagggttgtcggtgctatgaaggatgaactggcgagcaagcttgagctacatatggccatgtagtgttatagtggattagtactgatatcctaaataaaacgggccttcaggctctgaaaggattagtgcctctgtctgtggtggttttcatatgcttctagtatcaagcattgttcttaccgttgtctagttcatggataatgccttgcttgatccaagtttgtgctttgaatattccaacaaaataatataacctgtgttttgca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]