2024-07-03 19:17:04, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS XM_015763214 1412 bp mRNA linear PLN 07-AUG-2018 DEFINITION PREDICTED: Oryza sativa Japonica Group protein argonaute 2-like (LOC107278296), mRNA. ACCESSION XM_015763214 VERSION XM_015763214.2 DBLINK BioProject: PRJNA122 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_029267.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Aug 7, 2018 this sequence version replaced XM_015763214.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Oryza sativa Japonica Group Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1412 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /cultivar="Nipponbare" /db_xref="taxon:39947" /chromosome="12" gene 1..1412 /gene="LOC107278296" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 86 samples with support for all annotated introns" /db_xref="GeneID:107278296" CDS 267..875 /gene="LOC107278296" /codon_start=1 /product="protein argonaute 2-like" /protein_id="XP_015618700.1" /db_xref="GeneID:107278296" /translation="
MTRRVGGVRLLARASSGSQRWRRLAAAAGAAGDDDGLRRRRLAAAAGGRPPPGSGGGGPVAAGGEPSGGVGNGVAGDGDGLRRWRMGEARGKRLRAPPVGRIRRHSARARRGHRRRWVGRECLGGDGRGAQTARAGPDRDLLPTPVACKLSGARSGGYDWATADPGKASCSLVLPSPMTPTSLSSRRRRPPLDAVNVGSGLA"
ORIGIN
atgttacccctcacgtcctaccccccaccccaccctaccacaaccctcccctgccccaccgccgccgcctacggccaaggagtggcggcgtgcaggcgacgggcggccgacctaatcaccgcccactcccaccgggggtcgtcgtcgggttgtggccgtatcggcgtgcggctccggcagcggcagttcaggaatgaggaggagcggcggcgaggcgcatccagccacggctcggagacgaggaggttcgggcggtgaatccggtgatgacgaggcgcgtgggcggcgtgcggctattggctcgggcttcctccggtagccagcgatggcgacgccttgcggcagcggcgggcgcggccggcgacgacgacggcctgcgacggcgacggcttgcagcagcggcgggcggccgtcctccgcccggatccggcggcggcggcccggtggcggcgggaggagagcccagcggaggagtcggcaatggtgtggccggcgacggcgacggcttgcggcggtggaggatgggggaggcgagggggaagaggcttcgtgctcctccagtcgggcgcattcgccgccattccgcccgcgctcgccgaggccatcggcgccgctgggtagggcgcgagtgtcttggaggtgatgggcggggcgcgcagactgctcgtgccggacccgaccgggacctgctcccaactcccgtggcatgcaagttgagtggtgccagatccggcggctacgactgggcaacggctgatccggggaaggcttcgtgctcactggtgctgccttctcccatgactccgacctccctctctagccgccgccggcgtcccccgctggatgcagtcaatgtaggctcgggactcgcctgatctggggtggatcgacgaccattgggctgtcgaagcatagcagagacccaggcagaggtgtaggttgctgcttgcaggtccgccactgcccgtggacagacagtgctcgtcgatcgcattgctgtaggcgccagcgactagtcctgccaggcctgactggagaacggtgggatttggtgctgctgcaccctcagcggcgctggtatatgctcatgtgaatacaaccaagtacattttcagatccggttgctagccagtgccatggaggagcagcaacaaccacctccatgacgcgacgccgtcaatgtccagccagcgccagtcatctccgccaccaaccaccgactggtctctagatctatgttatattgtcatggagtaaaatgtttactcacaccatatgattgtttcatggcgtgtaggcttattgtaaaaaagttactattctcatatttctcattgtattcatatcgtgtaggcttattgtaaaacatttaccatgtgctaataagtgtccgtgaaaaatacttgagtcta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]