2024-09-29 10:27:38, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001402574 1480 bp mRNA linear PLN 08-APR-2024 DEFINITION Oryza sativa Japonica Group serotonin N-acetyltransferase 1, chloroplastic-like (SNAT1), mRNA; nuclear gene for chloroplast product. ACCESSION NM_001402574 XM_015782401 VERSION NM_001402574.1 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. REFERENCE 1 (bases 1 to 1480) AUTHORS Hwang,O.J. and Back,K. TITLE Simultaneous Suppression of Two Distinct Serotonin N-Acetyltransferase Isogenes by RNA Interference Leads to Severe Decreases in Melatonin and Accelerated Seed Deterioration in Rice JOURNAL Biomolecules 10 (1), 141 (2020) PUBMED 31952365 REMARK GeneRIF: Simultaneous Suppression of Two Distinct Serotonin N-Acetyltransferase Isogenes by RNA Interference Leads to Severe Decreases in Melatonin and Accelerated Seed Deterioration in Rice. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1480) AUTHORS Kikuchi,S., Satoh,K., Nagata,T., Kawagashira,N., Doi,K., Kishimoto,N., Yazaki,J., Ishikawa,M., Yamada,H., Ooka,H., Hotta,I., Kojima,K., Namiki,T., Ohneda,E., Yahagi,W., Suzuki,K., Li,C.J., Ohtsuki,K., Shishiki,T., Otomo,Y., Murakami,K., Iida,Y., Sugano,S., Fujimura,T., Suzuki,Y., Tsunoda,Y., Kurosaki,T., Kodama,T., Masuda,H., Kobayashi,M., Xie,Q., Lu,M., Narikawa,R., Sugiyama,A., Mizuno,K., Yokomizo,S., Niikura,J., Ikeda,R., Ishibiki,J., Kawamata,M., Yoshimura,A., Miura,J., Kusumegi,T., Oka,M., Ryu,R., Ueda,M., Matsubara,K., Kawai,J., Carninci,P., Adachi,J., Aizawa,K., Arakawa,T., Fukuda,S., Hara,A., Hashizume,W., Hayatsu,N., Imotani,K., Ishii,Y., Itoh,M., Kagawa,I., Kondo,S., Konno,H., Miyazaki,A., Osato,N., Ota,Y., Saito,R., Sasaki,D., Sato,K., Shibata,K., Shinagawa,A., Shiraki,T., Yoshino,M., Hayashizaki,Y. and Yasunishi,A. CONSRTM Rice Full-Length cDNA Consortium; National Institute of Agrobiological Sciences Rice Full-Length cDNA Project Team; Foundation of Advancement of International Science Genome Sequencing & Analysis Group; RIKEN TITLE Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice JOURNAL Science 301 (5631), 376-379 (2003) PUBMED 12869764 REMARK Erratum:[Science. 2003 Sep;301(5641):1849] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK059369.1, AU162147.1 and AP014961.1. On Mar 18, 2022 this sequence version replaced XM_015782401.2. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK059369.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00008650, SAMD00020311 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1198 AK059369.1 1-1198 1199-1345 AU162147.1 192-338 1346-1350 AP014961.1 23646817-23646821 1351-1480 AU162147.1 343-472 FEATURES Location/Qualifiers source 1..1480 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /db_xref="taxon:39947" /chromosome="5" /map="5" gene 1..1480 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /note="serotonin N-acetyltransferase 1, chloroplastic-like" /db_xref="GeneID:4339123" exon 1..324 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" CDS 186..950 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /EC_number="2.3.1.87" /note="LOC_Os05g40260; Nuclear shuttle protein-interacting protein homolog; OSJNBa0095J22.4; probable acetyltransferase NSI; acetyltransferase NSI homolog" /codon_start=1 /product="serotonin N-acetyltransferase 1, chloroplastic" /protein_id="NP_001389503.1" /db_xref="GeneID:4339123" /translation="
MAPAASASASAVVTPSSFRCVPTASCGLGARGKAPAPRRLLHDHAQGKKRAAATWSLKAGLWDSLRSGFLKSNNSTETVEPPSAPIEEEEPLPEELVLLERTLADGSTEQIIFSSAGDVNVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSVTMPSKAEGEERKQLIGMARATSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDISNITLFADNKVVDFYKNLGFEADPQGIKGMFWYPRF"
transit_peptide 186..407 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /note="Chloroplast. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q5KQI6.1)" mat_peptide 408..947 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /product="Serotonin N-acetyltransferase 1, chloroplastic. /id=PRO_0000333288" /note="propagated from UniProtKB/Swiss-Prot (Q5KQI6.1)" misc_feature 552..947 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /note="Predicted N-acetyltransferase YhbS [General function prediction only]; Region: yhbS; COG3153" /db_xref="CDD:442387" exon 325..388 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" exon 389..575 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" exon 576..675 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" exon 676..776 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" exon 777..870 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" exon 871..1466 /gene="SNAT1" /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1; SNAT" /inference="alignment:Splign:2.1.0" ORIGIN
taccactgaccactccatcagtccaccacccaccttccccgaccttatctgcgacgagacgacggcagcgagctccaccaccaccaccaccaccacctcctcctcctcccggcggcgaccgcctcggctgcgcccactccggcggcgcgcggcgacgaatcaccgggccgcactatccggcaaggatggcgcccgccgcctccgcctccgcctccgccgtcgtcacaccgtcctctttcagatgcgtccccacggcgtcgtgcggtttgggggcccggggtaaagcccccgcgccgcgccggcttctccacgaccacgcgcaaggtaaaaaacgggctgcggcaacttggtccttgaaggctggtctgtgggactcccttagatccggatttttgaagagtaataacagtacagagacagtagagccaccatcagcaccaattgaagaggaagaacctttgcccgaggaactagtactcctagaaaggacacttgctgatggcagcacagagcagatcatattttcttcagctggagatgttaatgtgtatgatctccaagctttatgcgacaaggtgggatggccacgcagacccctaaccaaaatagcagcatccttaagaaacagttacctggttgctacactacattcagttactatgccttcaaaagcagagggagaagagaggaagcaactaattggtatggcgcgagcaacttcagaccatgcctttaatgctaccatttgggatgttctcgttgacccttcatatcagggtcaaggtcttggtaaagcgttaatggagaaagtaatccgaactttgctccagagagacatcagcaatattacgctgtttgcagataacaaagttgtagatttctacaagaacttgggattcgaagctgaccctcaaggcatcaagggcatgttctggtaccccagattttagtgccagcggcctgacaccttcctgttcatcagtaatgcctggttctcaccgcccagggaccatagttttgtccagttgagtcgagctcagctgtgtaacagcaactctaactgaatggtggtgatatctgcaatatcttgttgtctgcaccacgagccatacaaattcagctgaattttcgagtcaaccttgtactgaaccaaacaaaacacttcttattgtcactagcaaaactgcaaagatccctgaaaaattcacctacagcaacggtcgcgccatggtgcacattgaacacatacacagcggagagataatgtccacaacttttataaggtttttctactgtaacgcacactgctgcgttcttctgtagaatttccactgcaaaagatgtgtgctgcgcgcgtcttctgtttcagtaaacgcgacatcgtccgtggcagcgtgcatgaccgtgggacaaagcacgtcgccgttgcagttttgtttttgtttgtttgtttttgtttttgtttaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]