GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-29 10:27:38, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       NM_001402574            1480 bp    mRNA    linear   PLN 08-APR-2024
DEFINITION  Oryza sativa Japonica Group serotonin N-acetyltransferase 1,
            chloroplastic-like (SNAT1), mRNA; nuclear gene for chloroplast
            product.
ACCESSION   NM_001402574 XM_015782401
VERSION     NM_001402574.1
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
REFERENCE   1  (bases 1 to 1480)
  AUTHORS   Hwang,O.J. and Back,K.
  TITLE     Simultaneous Suppression of Two Distinct Serotonin
            N-Acetyltransferase Isogenes by RNA Interference Leads to Severe
            Decreases in Melatonin and Accelerated Seed Deterioration in Rice
  JOURNAL   Biomolecules 10 (1), 141 (2020)
   PUBMED   31952365
  REMARK    GeneRIF: Simultaneous Suppression of Two Distinct Serotonin
            N-Acetyltransferase Isogenes by RNA Interference Leads to Severe
            Decreases in Melatonin and Accelerated Seed Deterioration in Rice.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1480)
  AUTHORS   Kikuchi,S., Satoh,K., Nagata,T., Kawagashira,N., Doi,K.,
            Kishimoto,N., Yazaki,J., Ishikawa,M., Yamada,H., Ooka,H., Hotta,I.,
            Kojima,K., Namiki,T., Ohneda,E., Yahagi,W., Suzuki,K., Li,C.J.,
            Ohtsuki,K., Shishiki,T., Otomo,Y., Murakami,K., Iida,Y., Sugano,S.,
            Fujimura,T., Suzuki,Y., Tsunoda,Y., Kurosaki,T., Kodama,T.,
            Masuda,H., Kobayashi,M., Xie,Q., Lu,M., Narikawa,R., Sugiyama,A.,
            Mizuno,K., Yokomizo,S., Niikura,J., Ikeda,R., Ishibiki,J.,
            Kawamata,M., Yoshimura,A., Miura,J., Kusumegi,T., Oka,M., Ryu,R.,
            Ueda,M., Matsubara,K., Kawai,J., Carninci,P., Adachi,J., Aizawa,K.,
            Arakawa,T., Fukuda,S., Hara,A., Hashizume,W., Hayatsu,N.,
            Imotani,K., Ishii,Y., Itoh,M., Kagawa,I., Kondo,S., Konno,H.,
            Miyazaki,A., Osato,N., Ota,Y., Saito,R., Sasaki,D., Sato,K.,
            Shibata,K., Shinagawa,A., Shiraki,T., Yoshino,M., Hayashizaki,Y.
            and Yasunishi,A.
  CONSRTM   Rice Full-Length cDNA Consortium; National Institute of
            Agrobiological Sciences Rice Full-Length cDNA Project Team;
            Foundation of Advancement of International Science Genome
            Sequencing & Analysis Group; RIKEN
  TITLE     Collection, mapping, and annotation of over 28,000 cDNA clones from
            japonica rice
  JOURNAL   Science 301 (5631), 376-379 (2003)
   PUBMED   12869764
  REMARK    Erratum:[Science. 2003 Sep;301(5641):1849]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK059369.1, AU162147.1 and AP014961.1.
            
            On Mar 18, 2022 this sequence version replaced XM_015782401.2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK059369.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00008650, SAMD00020311
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1198              AK059369.1         1-1198
            1199-1345           AU162147.1         192-338
            1346-1350           AP014961.1         23646817-23646821
            1351-1480           AU162147.1         343-472
FEATURES             Location/Qualifiers
     source          1..1480
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="5"
                     /map="5"
     gene            1..1480
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /note="serotonin N-acetyltransferase 1,
                     chloroplastic-like"
                     /db_xref="GeneID:4339123"
     exon            1..324
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
     CDS             186..950
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /EC_number="2.3.1.87"
                     /note="LOC_Os05g40260; Nuclear shuttle protein-interacting
                     protein homolog; OSJNBa0095J22.4; probable
                     acetyltransferase NSI; acetyltransferase NSI homolog"
                     /codon_start=1
                     /product="serotonin N-acetyltransferase 1, chloroplastic"
                     /protein_id="NP_001389503.1"
                     /db_xref="GeneID:4339123"
                     /translation="
MAPAASASASAVVTPSSFRCVPTASCGLGARGKAPAPRRLLHDHAQGKKRAAATWSLKAGLWDSLRSGFLKSNNSTETVEPPSAPIEEEEPLPEELVLLERTLADGSTEQIIFSSAGDVNVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSVTMPSKAEGEERKQLIGMARATSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDISNITLFADNKVVDFYKNLGFEADPQGIKGMFWYPRF"
     transit_peptide 186..407
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /note="Chloroplast. /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q5KQI6.1)"
     mat_peptide     408..947
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /product="Serotonin N-acetyltransferase 1, chloroplastic.
                     /id=PRO_0000333288"
                     /note="propagated from UniProtKB/Swiss-Prot (Q5KQI6.1)"
     misc_feature    552..947
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /note="Predicted N-acetyltransferase YhbS [General
                     function prediction only]; Region: yhbS; COG3153"
                     /db_xref="CDD:442387"
     exon            325..388
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
     exon            389..575
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
     exon            576..675
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
     exon            676..776
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
     exon            777..870
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
     exon            871..1466
                     /gene="SNAT1"
                     /gene_synonym="GNAT5; NSI; OsJ_018182; OsJ_18949; OsSNAT1;
                     SNAT"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
taccactgaccactccatcagtccaccacccaccttccccgaccttatctgcgacgagacgacggcagcgagctccaccaccaccaccaccaccacctcctcctcctcccggcggcgaccgcctcggctgcgcccactccggcggcgcgcggcgacgaatcaccgggccgcactatccggcaaggatggcgcccgccgcctccgcctccgcctccgccgtcgtcacaccgtcctctttcagatgcgtccccacggcgtcgtgcggtttgggggcccggggtaaagcccccgcgccgcgccggcttctccacgaccacgcgcaaggtaaaaaacgggctgcggcaacttggtccttgaaggctggtctgtgggactcccttagatccggatttttgaagagtaataacagtacagagacagtagagccaccatcagcaccaattgaagaggaagaacctttgcccgaggaactagtactcctagaaaggacacttgctgatggcagcacagagcagatcatattttcttcagctggagatgttaatgtgtatgatctccaagctttatgcgacaaggtgggatggccacgcagacccctaaccaaaatagcagcatccttaagaaacagttacctggttgctacactacattcagttactatgccttcaaaagcagagggagaagagaggaagcaactaattggtatggcgcgagcaacttcagaccatgcctttaatgctaccatttgggatgttctcgttgacccttcatatcagggtcaaggtcttggtaaagcgttaatggagaaagtaatccgaactttgctccagagagacatcagcaatattacgctgtttgcagataacaaagttgtagatttctacaagaacttgggattcgaagctgaccctcaaggcatcaagggcatgttctggtaccccagattttagtgccagcggcctgacaccttcctgttcatcagtaatgcctggttctcaccgcccagggaccatagttttgtccagttgagtcgagctcagctgtgtaacagcaactctaactgaatggtggtgatatctgcaatatcttgttgtctgcaccacgagccatacaaattcagctgaattttcgagtcaaccttgtactgaaccaaacaaaacacttcttattgtcactagcaaaactgcaaagatccctgaaaaattcacctacagcaacggtcgcgccatggtgcacattgaacacatacacagcggagagataatgtccacaacttttataaggtttttctactgtaacgcacactgctgcgttcttctgtagaatttccactgcaaaagatgtgtgctgcgcgcgtcttctgtttcagtaaacgcgacatcgtccgtggcagcgtgcatgaccgtgggacaaagcacgtcgccgttgcagttttgtttttgtttgtttgtttttgtttttgtttaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]