GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-20 10:46:13, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_028511               1077 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus claudin 34B2 (Cldn34b2), transcript variant 2, mRNA.
ACCESSION   NM_028511 XM_006528984
VERSION     NM_028511.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1077)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 1077)
  AUTHORS   Ingham,N.J., Pearson,S.A., Vancollie,V.E., Rook,V., Lewis,M.A.,
            Chen,J., Buniello,A., Martelletti,E., Preite,L., Lam,C.C.,
            Weiss,F.D., Powis,Z., Suwannarat,P., Lelliott,C.J., Dawson,S.J.,
            White,J.K. and Steel,K.P.
  TITLE     Mouse screen reveals multiple new genes underlying mouse and human
            hearing loss
  JOURNAL   PLoS Biol 17 (4), e3000194 (2019)
   PUBMED   30973865
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK006680.1 and BX119986.8.
            
            On Sep 30, 2017 this sequence version replaced XM_006528984.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK006680.1, BY706669.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression, longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-894               AK006680.1         2-895
            895-1077            BX119986.8         108549-108731       c
FEATURES             Location/Qualifiers
     source          1..1077
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 72.38 cM"
     gene            1..1077
                     /gene="Cldn34b2"
                     /gene_synonym="1700042B14Rik"
                     /note="claudin 34B2"
                     /db_xref="GeneID:73347"
                     /db_xref="MGI:MGI:1920597"
     exon            1..138
                     /gene="Cldn34b2"
                     /gene_synonym="1700042B14Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    86..88
                     /gene="Cldn34b2"
                     /gene_synonym="1700042B14Rik"
                     /note="upstream in-frame stop codon"
     exon            139..1077
                     /gene="Cldn34b2"
                     /gene_synonym="1700042B14Rik"
                     /inference="alignment:Splign:2.1.0"
     CDS             164..793
                     /gene="Cldn34b2"
                     /gene_synonym="1700042B14Rik"
                     /codon_start=1
                     /product="claudin 34B2"
                     /protein_id="NP_082787.1"
                     /db_xref="CCDS:CCDS53232.1"
                     /db_xref="GeneID:73347"
                     /db_xref="MGI:MGI:1920597"
                     /translation="
MPLKKCHGQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVVLKPTVALVGMWRACVFHTDRNSSNTRVCYQYNYDGSIPLYIRGNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDTRKMGSAMALAIIAAVFFLLSGTICLSSNLNIDKTPRSKM"
     misc_feature    215..751
                     /gene="Cldn34b2"
                     /gene_synonym="1700042B14Rik"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
cagagctggtggttaagccagcaaggagcctcaaagtcctagtgagaggaccaatttccttgttgcctctactgcctcgcataactgactgccaagcaacatcatctaccatcagttcacttgtgaattgtgtctctgttctcaagtattcactgccatcatcatgccgttgaaaaagtgccatggccaaatgggaggttttgctttgaccactgtggcctggctactctgctgcatatccacaggcctccctcagtggcaagtgtggcactatgaagatcctgtggtcctcaagcctacagtggctttagtgggcatgtggagagcctgcgttttccacaccgacagaaactccagcaacaccagagtatgttaccaatacaactacgatggctccattcctttgtatattcgaggaaaccagcacttgctgctggtttctagctttcttgggctttttgggaaaatcactaccattattgctctttcgaatgtgcatatgggaagagtacggaggaatgccacctgcaatcctttcagactttcaggcatactgaacatcattgctagcagctttctttaccttgctgttttgttcaattacatagccatcatgagcaaatgggggattgccttcccaccatctttcaatttgcctttccagccagacactcggaagatgggaagtgccatggctttggcaattatagctgcagttttctttctactaagtggcacaatttgcctttcttcaaatttaaacatagacaagacgccccgttccaaaatgtaaatcgatacgttacatagccttgaaatgccagcaaagataatgagtattctttacatgtctacacaaattttcaaagaacttgaaaggatgccgattgtggcctgcgggaaaaaaataatccagttgactttctcttatctttttttggcttcttttgtgtttccttaatgcattatttggattgtgggcttttattaaataaaatattattttatgggtagtattgatttgtgttctacttgctgtcaaaaatagcatacaatcaataaacctaatccatattc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]