LOCUS       NM_021719               1878 bp    mRNA    linear   ROD 07-AUG-2024
DEFINITION  Mus musculus claudin 15 (Cldn15), mRNA.
ACCESSION   NM_021719
VERSION     NM_021719.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1878)
  AUTHORS   Audiger,C., Laabi,Y., Nie,J., Gibson,L., Wilson-Annan,J.,
            Brook-Carter,P., Kueh,A., Harris,A.W., Naik,S., Nutt,S.L.,
            Strasser,A., Adams,J.M., Bouillet,P. and Chopin,M.
  TITLE     Mis-expression of GATA6 re-programs cell fate during early
            hematopoiesis
  JOURNAL   Cell Rep 43 (5), 114159 (2024)
   PUBMED   38676923
REFERENCE   2  (bases 1 to 1878)
  AUTHORS   Hempstock,W., Nagata,N., Ishizuka,N. and Hayashi,H.
  TITLE     The effect of claudin-15 deletion on cationic selectivity and
            transport in paracellular pathways of the cecum and large intestine
  JOURNAL   Sci Rep 13 (1), 6799 (2023)
   PUBMED   37100833
  REMARK    GeneRIF: The effect of claudin-15 deletion on cationic selectivity
            and transport in paracellular pathways of the cecum and large
            intestine.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1878)
  AUTHORS   Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and
            Chiba,H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1878)
  AUTHORS   Nakayama,M., Ishizuka,N., Hempstock,W., Ikari,A. and Hayashi,H.
  TITLE     Na+-Coupled Nutrient Cotransport Induced Luminal Negative Potential
            and Claudin-15 Play an Important Role in Paracellular Na+ Recycling
            in Mouse Small Intestine
  JOURNAL   Int J Mol Sci 21 (2), 376 (2020)
   PUBMED   31936130
  REMARK    GeneRIF: Na(+)-Coupled Nutrient Cotransport Induced Luminal
            Negative Potential and Claudin-15 Play an Important Role in
            Paracellular Na(+) Recycling in Mouse Small Intestine.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1878)
  AUTHORS   Ishizuka,N., Nakayama,M., Watanabe,M., Tajima,H., Yamauchi,Y.,
            Ikari,A. and Hayashi,H.
  TITLE     Luminal Na+ homeostasis has an important role in intestinal peptide
            absorption in vivo
  JOURNAL   Am J Physiol Gastrointest Liver Physiol 315 (5), G799-G809 (2018)
   PUBMED   30138575
REFERENCE   6  (bases 1 to 1878)
  AUTHORS   Inai,T., Sengoku,A., Guan,X., Hirose,E., Iida,H. and Shibata,Y.
  TITLE     Heterogeneity in expression and subcellular localization of tight
            junction proteins, claudin-10 and -15, examined by RT-PCR and
            immunofluorescence microscopy
  JOURNAL   Arch Histol Cytol 68 (5), 349-360 (2005)
   PUBMED   16505581
REFERENCE   7  (bases 1 to 1878)
  AUTHORS   Hatakeyama,J., Bessho,Y., Katoh,K., Ookawara,S., Fujioka,M.,
            Guillemot,F. and Kageyama,R.
  TITLE     Hes genes regulate size, shape and histogenesis of the nervous
            system by control of the timing of neural stem cell differentiation
  JOURNAL   Development 131 (22), 5539-5550 (2004)
   PUBMED   15496443
REFERENCE   8  (bases 1 to 1878)
  AUTHORS   Van Itallie,C.M., Fanning,A.S. and Anderson,J.M.
  TITLE     Reversal of charge selectivity in cation or anion-selective
            epithelial lines by expression of different claudins
  JOURNAL   Am J Physiol Renal Physiol 285 (6), F1078-F1084 (2003)
   PUBMED   13129853
REFERENCE   9  (bases 1 to 1878)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   10 (bases 1 to 1878)
  AUTHORS   Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J Cell Biol 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK008683.1, BB801129.1 and
            CF545718.1.
            
            On Aug 11, 2010 this sequence version replaced NM_021719.3.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. This protein increases permeability for
            sodium ions in anion-selective epithelial cell sheets. The gene
            deficiency leads to megaintestine and decreases in intestinal
            epithelial paracellular ion permeability. This gene is a direct
            target for hepatocyte-nuclear-factor-4alpha, a mediator of ion
            epithelial transport, and is down-modulated in inflammatory bowel
            disease. [provided by RefSeq, Aug 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC023428.1, AK008683.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1745              AK008683.1         2-1746
            1746-1850           BB801129.1         283-387
            1851-1878           CF545718.1         229-256
FEATURES             Location/Qualifiers
     source          1..1878
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 76.07 cM"
     gene            1..1878
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="claudin 15"
                     /db_xref="GeneID:60363"
                     /db_xref="MGI:MGI:1913103"
     exon            1..455
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    98..100
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="upstream in-frame stop codon"
     CDS             239..922
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /codon_start=1
                     /product="claudin-15"
                     /protein_id="NP_068365.1"
                     /db_xref="CCDS:CCDS19758.1"
                     /db_xref="GeneID:60363"
                     /db_xref="MGI:MGI:1913103"
                     /translation="

MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNMDLSKKAKLLAIAGTLHILAGACGMVAISWYAVNITTDFFNPLYAGTKYELGPALYLGWSASLLSILGGICVFSTCCCSSKEEPATRAGLPYKPSTVVIPRATSDESDISFGKYGKNAYV"

     misc_feature    242..310
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S5.2);
                     transmembrane region"
     misc_feature    317..769
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    401..403
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Important for Na(+)-selective paracellular ion
                     transport. /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); other site"
     misc_feature    428..430
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Important for Na(+)-selective paracellular ion
                     transport. /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); other site"
     misc_feature    440..442
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Important for the formation of tight-junction
                     strand-like structures; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); other site"
     misc_feature    461..535
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S5.2);
                     transmembrane region"
     misc_feature    569..571
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56746; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); phosphorylation site"
     misc_feature    584..658
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S5.2);
                     transmembrane region"
     misc_feature    674..679
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S5.2);
                     Region: Important for the formation of tight-junction
                     strand-like structures"
     misc_feature    716..784
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S5.2);
                     transmembrane region"
     misc_feature    869..871
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:D3ZQJ0; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); phosphorylation site"
     misc_feature    878..880
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); phosphorylation site"
     misc_feature    887..889
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (Q9Z0S5.2); phosphorylation site"
     exon            456..620
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            621..702
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            703..819
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            820..1851
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1828..1833
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="hexamer: AATAAA"
     polyA_site      1847
                     /gene="Cldn15"
                     /gene_synonym="2210009B08Rik"
                     /note="major polyA site"
ORIGIN      

attcctctgacctgccaggaagcagagcctcccagagaccaggcagaggcactcagacctgacctccagaagacggcagacaagaatcgcagctggatgagcgctccttcagccttctccctcctcagtcttccgtgacatcccttttgggccaaagcccccggaattcacctggaggtgccaactctccctctcaatccctggggctcaagcccccttgggggacctgcatcccagcatgtcggtagctgtggagaccttcggcttcttcatgtcagccctgggactgctgatgctggggttgaccctttcaaacagctactggagagtgtctacggtccatggcaacgtcatcaccaccaacaccatctttgagaacctgtggtacagctgtgccaccgactccctgggagtctccaactgctgggactttccgtccatgctggccctctctgggtatgtccagggctgccgggctctcatgatcaccgccatcctcctgggcttcctgggcctctttctaggcatggtgggactccgctgcaccaacgtgggcaacatggatctctccaagaaggccaagctgctggccattgcagggaccctccacatacttgctggagcctgtgggatggtggctatctcgtggtacgccgtcaacatcactactgacttcttcaacccactgtatgctggaaccaagtatgaactgggccccgccctctacttgggctggagtgcctccctgctctccatcctgggcggcatctgtgtcttctccacctgctgctgttcctccaaggaggaaccagccaccagggctgggcttccctacaagccttctacggttgtgataccccgtgccacctcggatgagagtgacatcagcttcggtaaatatggcaaaaacgcatacgtgtaggaagctctggcctgctggacaccatttcttgtcccactgtctccaggacctgcaggcagaccagtctccagttaataacctcaggacaggccaaatttcctggcctcaccctgtgcctggaagccactacccactctaggcacaccttatctggcactcagcctctccctggaacagaagcttcaggggcaacttgcctgcttcttacagctggacacaaggggacagaggtgtctgcagcatgtgactccatataaatgtgtgcatgaataaatgtatattgtgattgttcagggggcaccaggggtcatggagtcacagccacataagggagtccttttcaaaccacagactgtcaagtctgcccaatttgggggctgtctcatctagtgagatagtgtgtcagggagctggggagatggctcagtgagttgagtgtttgctacccaagtatgaggacctgagttcaaatccccagaacctgtgtaaatggcaggccatggatacaatcctgcaacccaagtatgctaggttgaggtattcttgaggcttcctggcttccaccctggctccaggctccatatgagacgcagtcttaagggaatgaggtggagcgcgatggagcagggagctggaaaccctcttcccaccttctcaggcacacagacttgtacatagactacacacatgcacacattctcaacaaaaggatttgaaagggggagtcactaacaactgatctgagtcacccacctcaggagattgctaatagctgtgatgctcctggcctgctgaaagttcctctctgttgactcttgacctattttctcacagtctcacacaggggcagttgatctagaacaggcattggtaggtgcatgtgtgtttgaaggtttggggtttaaaataaagatattttaaatgatgcaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//