2025-04-20 02:34:11, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_010463 962 bp mRNA linear ROD 02-MAY-2024 DEFINITION Mus musculus homeobox C12 (Hoxc12), mRNA. ACCESSION NM_010463 VERSION NM_010463.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 962) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 2 (bases 1 to 962) AUTHORS Hauswirth,G.M., Garside,V.C., Wong,L.S.F., Bildsoe,H., Manent,J., Chang,Y.C., Nefzger,C.M., Firas,J., Chen,J., Rossello,F.J., Polo,J.M. and McGlinn,E. TITLE Breaking constraint of mammalian axial formulae JOURNAL Nat Commun 13 (1), 243 (2022) PUBMED 35017475 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 962) AUTHORS Fernandez-Guerrero,M., Yakushiji-Kaminatsui,N., Lopez-Delisle,L., Zdral,S., Darbellay,F., Perez-Gomez,R., Bolt,C.C., Sanchez-Martin,M.A., Duboule,D. and Ros,M.A. TITLE Mammalian-specific ectodermal enhancers control the expression of Hoxc genes in developing nails and hair follicles JOURNAL Proc Natl Acad Sci U S A 117 (48), 30509-30519 (2020) PUBMED 33199643 REFERENCE 4 (bases 1 to 962) AUTHORS Higashijima,Y., Nagai,N., Yamamoto,M., Kitazawa,T., Kawamura,Y.K., Taguchi,A., Nakada,N., Nangaku,M., Furukawa,T., Aburatani,H., Kurihara,H., Wada,Y. and Kanki,Y. TITLE Lysine demethylase 7a regulates murine anterior-posterior development by modulating the transcription of Hox gene cluster JOURNAL Commun Biol 3 (1), 725 (2020) PUBMED 33257809 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 962) AUTHORS Sato,T., Kataoka,K., Ito,Y., Yokoyama,S., Inui,M., Mori,M., Takahashi,S., Akita,K., Takada,S., Ueno-Kudoh,H. and Asahara,H. TITLE Lin28a/let-7 pathway modulates the Hox code via Polycomb regulation during axial patterning in vertebrates JOURNAL Elife 9, e53608 (2020) PUBMED 32479258 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 962) AUTHORS Shang,L., Pruett,N.D. and Awgulewitsch,A. TITLE Hoxc12 expression pattern in developing and cycling murine hair follicles JOURNAL Mech Dev 113 (2), 207-210 (2002) PUBMED 11960714 REFERENCE 7 (bases 1 to 962) AUTHORS Peterson,R.L., Papenbrock,T., Davda,M.M. and Awgulewitsch,A. TITLE The murine Hoxc cluster contains five neighboring AbdB-related Hox genes that show unique spatially coordinated expression in posterior embryonic subregions JOURNAL Mech Dev 47 (3), 253-260 (1994) PUBMED 7848872 REFERENCE 8 (bases 1 to 962) AUTHORS Bradshaw,M.S. and Ruddle,F.H. TITLE Identification of the murine Hox-c12 and Hox-c13 homeoboxes on yeast artificial chromosomes JOURNAL Genomics 22 (1), 234-236 (1994) PUBMED 7959778 REFERENCE 9 (bases 1 to 962) AUTHORS Brannan,C.I., Gilbert,D.J., Ceci,J.D., Matsuda,Y., Chapman,V.M., Mercer,J.A., Eisen,H., Johnston,L.A., Copeland,N.G. and Jenkins,N.A. TITLE An interspecific linkage map of mouse chromosome 15 positioned with respect to the centromere JOURNAL Genomics 13 (4), 1075-1081 (1992) PUBMED 1354638 REFERENCE 10 (bases 1 to 962) AUTHORS Singh,G., Kaur,S., Stock,J.L., Jenkins,N.A., Gilbert,D.J., Copeland,N.G. and Potter,S.S. TITLE Identification of 10 murine homeobox genes JOURNAL Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991) PUBMED 1683707 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC120845.1. On Feb 16, 2019 this sequence version replaced NM_010463.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC120847.1, AF448482.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164137, SAMN01164142 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 5' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-962 BC120845.1 70-1031 FEATURES Location/Qualifiers source 1..962 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="15" /map="15 58.01 cM" gene 1..962 /gene="Hoxc12" /gene_synonym="Hox-3.8" /note="homeobox C12" /db_xref="GeneID:15421" /db_xref="MGI:MGI:96194" exon 1..631 /gene="Hoxc12" /gene_synonym="Hox-3.8" /inference="alignment:Splign:2.1.0" CDS 28..870 /gene="Hoxc12" /gene_synonym="Hox-3.8" /note="homeobox protein Hox-3.8; homeo box C12; Homeobox protein Hox-C12 (Hox-3F)" /codon_start=1 /product="homeobox protein Hox-C12" /protein_id="NP_034593.1" /db_xref="CCDS:CCDS27891.1" /db_xref="GeneID:15421" /db_xref="MGI:MGI:96194" /translation="
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYTASGGGGDGSTGPPHDPPSCQSLESDSSSSLLNEGNKSASAGDPGSLVSPLNPGGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF"
misc_feature 310..663 /gene="Hoxc12" /gene_synonym="Hox-3.8" /note="propagated from UniProtKB/Swiss-Prot (Q8K5B8.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 664..834 /gene="Hoxc12" /gene_synonym="Hox-3.8" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 632..962 /gene="Hoxc12" /gene_synonym="Hox-3.8" /inference="alignment:Splign:2.1.0" ORIGIN
agaagcagccggtcgggccccgcggaaatgggcgagcataatctcctgaatcctgggtttgtggggccgctggtgaatatccacacaggagacaccttctacttccccaacttccgcgcgtcaggggcacaactcccggggctgccttcgctgtcctacccacgccgcgacaacgtgtgctcgctgccttggccgtcggccgagccgtgcaatggctacccacagccctatctcggcagtcccgtgtctctcaacccgcctttcggccgcacgtgcgagttggctcgcgtggaggatagcaagggttactaccgagaaccctgcgctgagggcggcggcgggggcctaaagcgggaggagcgcgggcgcgaacccggagcgggacccggggcagcgctactgcagctggagccgtcggggccacctgcgctcggcttcaagtacgactacacggcgagcggcggcggtggcgacggcagcacgggacccccccacgatccaccctcgtgccagtcactggaatccgactccagttcgtccctactcaacgagggcaataagagcgccagcgctggtgaccctggctctctggtttcgccgttgaacccaggcggcgggctctcagccagcggcgcgccctggtacccgatccacagccgctcgcgaaagaagcgcaagccgtattcgaagttgcagctggctgagctggagggcgagtttctggtcaacgagttcatcacacgccagcgtcggagggaactctcggaccgcttgaatcttagtgatcagcaggtcaagatttggttccagaaccggagaatgaaaaagaaaagacttctgctgagggagcaagctctctccttcttctagggagcaggacaagcgtgctagccccagactaagcttgccttggtggagcaagagggggcgcagcctgggacatagtcccgcttacaacgcca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]