LOCUS       NM_008759               1296 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus SEBOX homeobox (Sebox), mRNA.
ACCESSION   NM_008759
VERSION     NM_008759.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1296)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 1296)
  AUTHORS   Goetz,J.J., Laboissonniere,L.A., Wester,A.K., Lynch,M.R. and
            Trimarchi,J.M.
  TITLE     Polo-Like Kinase 3 Appears Dispensable for Normal Retinal
            Development Despite Robust Embryonic Expression
  JOURNAL   PLoS One 11 (3), e0150878 (2016)
   PUBMED   26949938
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1296)
  AUTHORS   Park,M.W., Kim,K.H., Kim,E.Y., Lee,S.Y., Ko,J.J. and Lee,K.A.
  TITLE     Associations among Sebox and other MEGs and its effects on early
            embryogenesis
  JOURNAL   PLoS One 10 (2), e0115050 (2015)
   PUBMED   25679966
  REMARK    GeneRIF: Sebox is important in preparing oocytes for embryonic
            development by orchestrating the expression of other important MEGs
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1296)
  AUTHORS   Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K.,
            Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C.,
            Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R.,
            Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K.,
            Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J.,
            Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P.,
            Hawrylycz,M.J., Puelles,L. and Jones,A.R.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   5  (bases 1 to 1296)
  AUTHORS   Wiese,C.B., Ireland,S., Fleming,N.L., Yu,J., Valerius,M.T.,
            Georgas,K., Chiu,H.S., Brennan,J., Armstrong,J., Little,M.H.,
            McMahon,A.P. and Southard-Smith,E.M.
  TITLE     A genome-wide screen to identify transcription factors expressed in
            pelvic Ganglia of the lower urinary tract
  JOURNAL   Front Neurosci 6, 130 (2012)
   PUBMED   22988430
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1296)
  AUTHORS   Yokoyama,S., Ito,Y., Ueno-Kudoh,H., Shimizu,H., Uchibe,K.,
            Albini,S., Mitsuoka,K., Miyaki,S., Kiso,M., Nagai,A., Hikata,T.,
            Osada,T., Fukuda,N., Yamashita,S., Harada,D., Mezzano,V., Kasai,M.,
            Puri,P.L., Hayashizaki,Y., Okado,H., Hashimoto,M. and Asahara,H.
  TITLE     A systems approach reveals that the myogenesis genome network is
            regulated by the transcriptional repressor RP58
  JOURNAL   Dev Cell 17 (6), 836-848 (2009)
   PUBMED   20059953
REFERENCE   7  (bases 1 to 1296)
  AUTHORS   Kim,K.H., Kim,E.Y. and Lee,K.A.
  TITLE     SEBOX is essential for early embryogenesis at the two-cell stage in
            the mouse
  JOURNAL   Biol Reprod 79 (6), 1192-1201 (2008)
   PUBMED   18753614
  REMARK    GeneRIF: Sebox is a new addition to maternal effect genes that
            produced and stored in oocytes and function in preimplantation
            embryo
REFERENCE   8  (bases 1 to 1296)
  AUTHORS   Mink,M., Fogelgren,B., Olszewski,K., Maroy,P. and Csiszar,K.
  TITLE     A novel human gene (SARM) at chromosome 17q11 encodes a protein
            with a SAM motif and structural similarity to
            Armadillo/beta-catenin that is conserved in mouse, Drosophila, and
            Caenorhabditis elegans
  JOURNAL   Genomics 74 (2), 234-244 (2001)
   PUBMED   11386760
REFERENCE   9  (bases 1 to 1296)
  AUTHORS   Cinquanta,M., Rovescalli,A.C., Kozak,C.A. and Nirenberg,M.
  TITLE     Mouse Sebox homeobox gene expression in skin, brain, oocytes, and
            two-cell embryos
  JOURNAL   Proc Natl Acad Sci U S A 97 (16), 8904-8909 (2000)
   PUBMED   10922053
REFERENCE   10 (bases 1 to 1296)
  AUTHORS   Rovescalli,A.C., Asoh,S. and Nirenberg,M.
  TITLE     Cloning and characterization of four murine homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 93 (20), 10691-10696 (1996)
   PUBMED   8855241
  REMARK    Erratum:[Proc Natl Acad Sci U S A 1996 Dec 24;93(26):15522]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL591177.14.
            
            On Apr 13, 2021 this sequence version replaced NM_008759.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC098184.1, AK143429.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-76                AL591177.14        42635-42710
            77-237              AL591177.14        42872-43032
            238-1296            AL591177.14        43156-44214
FEATURES             Location/Qualifiers
     source          1..1296
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 46.74 cM"
     gene            1..1296
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="SEBOX homeobox"
                     /db_xref="GeneID:18292"
                     /db_xref="MGI:MGI:108012"
     exon            1..76
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /inference="alignment:Splign:2.1.0"
     CDS             49..621
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="homeobox OG-9; skin-, embryo-, brain- and
                     oocyte-specific homeobox; OG9 homeobox"
                     /codon_start=1
                     /product="homeobox protein SEBOX"
                     /protein_id="NP_032785.1"
                     /db_xref="CCDS:CCDS25107.1"
                     /db_xref="GeneID:18292"
                     /db_xref="MGI:MGI:108012"
                     /translation="

MASPVEASPGCASGLGPHRRKRTTFSVGQLVELERVFAARPYPDISTREHLAQVTHLPEAKIQVWFQNRRAKRIKDRKPGALNSRLELPPNSCSLPDTPQLPWDPGTSSHPLHPTSSAQYTSACPPQTSCLGPILGPGQSWSGAKVAAPWGTSGASGIHSSLEQIVPQTSLGNLSDLIYTSAIVTNVDHF"

     misc_feature    49..108
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="propagated from UniProtKB/Swiss-Prot (P70368.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    103..264
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    274..417
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="propagated from UniProtKB/Swiss-Prot (P70368.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            77..237
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /inference="alignment:Splign:2.1.0"
     exon            238..1296
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1277..1282
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="hexamer: AACAAA"
     polyA_site      1296
                     /gene="Sebox"
                     /gene_synonym="OG9; Og9x"
                     /note="major polyA site"
ORIGIN      

gaaacagccctggcatggccctctggctcctcaccccatgtcagctccatggccagtcctgtggaggcatctccaggctgtgccagtgggttgggtccccatcggaggaagaggaccactttcagtgtcgggcagttggtggagctggagcgggtatttgcagctaggccctatcctgacatcagcacccgtgagcacctggctcaggtaactcacctgcctgaagccaagatccaggtgtggttccagaatcggcgagccaagagaatcaaggacagaaagccaggagccctaaactccaggctggagcttcccccaaactcctgttctcttccagacactccccagctaccttgggaccctggaacatcaagccatcctctgcaccctaccagttcagctcagtatacttcagcatgcccaccacagacctcctgcctaggccccattttgggtccagggcagagttggtcaggggctaaagtggcagccccatgggggacaagtggggcttcagggattcactcttctttagagcaaattgttcctcagacttcactgggcaacctgtctgaccttatctatacctcagccatcgtcaccaatgtagaccacttctaatttaggtgtagagcttttaagtcttggctctggccttgtagcccataggacagagcacataagagaactcctgcctctttttttgcacagagtgtttgctaacagtttggctcagggactcccacccccatccctagtctccaccagtttagttggggtcctgtgactggagcctgcctcctaaaactcggcatcctggtccttttggggacatgagcatcaggaggtactgttaaagtgagggactacattttccacctttactgacaggtttgggtccccaactcctattatcttagcagaatgatctccttcctctaaaggggcagccaccagtctaagagggcccttcaggacctcacatatgtgccaggggcagggtactggtctgctgggacccacattttcaaggttcagggccccattgcctgacttcctgccacctggacaaattaatcagaactgtggatctgaagagagagtgatattaaagttacagaaatagaagcctgggtcttagctttattgaatttccccaaagatcagtttggctgccttctgatgtgggctgcggggacaacctaacagaactggggggtgggggtggggtgtgtggtatcactggcatgtgtaataccaactaatctccaaataaaacaaaactctttgctttaa

//