2025-08-21 23:01:31, GGRNA.v2 : RefSeq release 230 (May, 2025)
LOCUS NM_008274 2534 bp mRNA linear ROD 15-JUL-2024 DEFINITION Mus musculus homeobox D12 (Hoxd12), mRNA. ACCESSION NM_008274 VERSION NM_008274.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2534) AUTHORS Charng,W.L., Nikolov,M., Shrestha,I., Seeley,M.A., Josyula,N.S., Justice,A.E., Dobbs,M.B. and Gurnett,C.A. TITLE Exome sequencing of 1190 non-syndromic clubfoot cases reveals HOXD12 as a novel disease gene JOURNAL J Med Genet 61 (7), 699-706 (2024) PUBMED 38663984 REMARK GeneRIF: Exome sequencing of 1190 non-syndromic clubfoot cases reveals HOXD12 as a novel disease gene. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2534) AUTHORS Chen,Y., Zhou,T., Liao,Z., Gao,W., Wu,J., Zhang,S., Li,Y., Liu,H., Zhou,H., Xu,C. and Su,P. TITLE Hnrnpk is essential for embryonic limb bud development as a transcription activator and a collaborator of insulator protein Ctcf JOURNAL Cell Death Differ 30 (10), 2293-2308 (2023) PUBMED 37608075 REFERENCE 3 (bases 1 to 2534) AUTHORS Kumar,S., Alam,S.S., Bareke,E., Beauchamp,M.C., Dong,Y., Chan,W., Majewski,J. and Jerome-Majewska,L.A. TITLE Sf3b4 regulates chromatin remodeler splicing and Hox expression JOURNAL Differentiation 131, 59-73 (2023) PUBMED 37167859 REFERENCE 4 (bases 1 to 2534) AUTHORS Chang,Y.C., Manent,J., Schroeder,J., Wong,S.F.L., Hauswirth,G.M., Shylo,N.A., Moore,E.L., Achilleos,A., Garside,V., Polo,J.M., Trainor,P. and McGlinn,E. TITLE Nr6a1 controls Hox expression dynamics and is a master regulator of vertebrate trunk development JOURNAL Nat Commun 13 (1), 7766 (2022) PUBMED 36522318 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 2534) AUTHORS Bolt,C.C., Lopez-Delisle,L., Hintermann,A., Mascrez,B., Rauseo,A., Andrey,G. and Duboule,D. TITLE Context-dependent enhancer function revealed by targeted inter-TAD relocation JOURNAL Nat Commun 13 (1), 3488 (2022) PUBMED 35715427 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 2534) AUTHORS Chan,D.C., Wynshaw-Boris,A. and Leder,P. TITLE Formin isoforms are differentially expressed in the mouse embryo and are required for normal expression of fgf-4 and shh in the limb bud JOURNAL Development 121 (10), 3151-3162 (1995) PUBMED 7588050 REFERENCE 7 (bases 1 to 2534) AUTHORS Dolle,P., Izpisua-Belmonte,J.C., Boncinelli,E. and Duboule,D. TITLE The Hox-4.8 gene is localized at the 5' extremity of the Hox-4 complex and is expressed in the most posterior parts of the body during development JOURNAL Mech Dev 36 (1-2), 3-13 (1991) PUBMED 1685889 REFERENCE 8 (bases 1 to 2534) AUTHORS Izpisua-Belmonte,J.C., Falkenstein,H., Dolle,P., Renucci,A. and Duboule,D. TITLE Murine genes related to the Drosophila AbdB homeotic genes are sequentially expressed during development of the posterior part of the body JOURNAL EMBO J 10 (8), 2279-2289 (1991) PUBMED 1676674 REFERENCE 9 (bases 1 to 2534) AUTHORS Duboule,D., Boncinelli,E., DeRobertis,E., Featherstone,M., Lonai,P., Oliver,G. and Ruddle,F.H. TITLE An update of mouse and human HOX gene nomenclature JOURNAL Genomics 7 (3), 458-459 (1990) PUBMED 1973145 REFERENCE 10 (bases 1 to 2534) AUTHORS Dolle,P., Izpisua-Belmonte,J.C., Falkenstein,H., Renucci,A. and Duboule,D. TITLE Coordinate expression of the murine Hox-5 complex homoeobox-containing genes during limb pattern formation JOURNAL Nature 342 (6251), 767-772 (1989) PUBMED 2574828 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL928644.12 and AK031206.1. On Aug 2, 2012 this sequence version replaced NM_008274.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK031206.1, BC145656.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849381, SAMN00849389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-62 AL928644.12 159945-160006 63-1482 AK031206.1 2-1421 1483-1483 AL928644.12 161586-161586 1484-2534 AK031206.1 1423-2473 FEATURES Location/Qualifiers source 1..2534 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="2" /map="2 44.13 cM" gene 1..2534 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /note="homeobox D12" /db_xref="GeneID:15432" /db_xref="MGI:MGI:96204" exon 1..642 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /inference="alignment:Splign:2.1.0" CDS 75..881 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /note="homeobox protein Hox-4.7; homeobox protein Hox-5.6; homeo box D12" /codon_start=1 /product="homeobox protein Hox-D12" /protein_id="NP_032300.2" /db_xref="CCDS:CCDS38147.1" /db_xref="GeneID:15432" /db_xref="MGI:MGI:96204" /translation="
MCERSLYRAGYVGSLLNLQSPDSFYFSNLRANGSQLAALPPISYPRSALPWATTPASCTPAQPATASAFGGFSQPYLTGSGPIGLQSPGAKDGPEDQVKFYTPDAPTASEERSRTRPPFAPESSLVHSALKGTKYDYAGVGRTAPGSATLLQGAPCASSFKEDTKGPLNLNMAVQVAGVASCLRSSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQALALY"
misc_feature <183..443 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /note="large tegument protein UL36; Provisional; Region: PHA03247" /db_xref="CDD:223021" misc_feature 378..446 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /note="propagated from UniProtKB/Swiss-Prot (P23812.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 675..845 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 643..2534 /gene="Hoxd12" /gene_synonym="Hox-4.7; Hox-5.6" /inference="alignment:Splign:2.1.0" ORIGIN
cctctgagcccgtcctcctattccgggttgtaactaaatactgttgcgagcacagccgaggccctttgttggagatgtgtgagcgcagtctctacagagctggctatgtgggctcgcttctgaatttacagtcaccggactctttctacttttccaacctgagagccaatggcagccagttggccgcgcttccccccatctcataccctcgcagcgcgctgccctgggctactacgcccgcctcatgcacccctgcgcagcctgccaccgcctctgcctttggaggcttctctcagccttacttgaccggctctgggccaattggcctgcagtctccaggcgccaaggacggacccgaagaccaggtcaagttctatacgcctgatgcgcccaccgcatctgaggaacgcagccggactaggccgcccttcgcccccgagtctagtctggttcattcggctctcaaaggcaccaagtatgactacgcgggtgtgggccggaccgctccaggctctgcgaccctgctccagggggccccctgtgcctccagcttcaaggaagacaccaaaggcccgctcaacttgaacatggcagtgcaagtggccggggtggcctcttgcctgcgatcttcactgcccgacggcctgccgtggggggcggccccggggagggcccgcaagaagaggaaaccctacacaaagcagcagattgcggagctggagaacgaattcctggtcaatgaattcatcaaccggcagaagcgtaaggaattgtctaacaggctgaacctcagcgaccagcaggtcaaaatctggttccagaaccggcgtatgaagaagaagcgggtagtgcagcgcgagcaagcactggccctctattagctgcccacgggggcctgaggccttgccaagcctgcccttttggaccaaggcctggctgtggaggaggtgttggggctgcagatttccctcccactcctctggtcctgggcgcccttcggctcagtctgtagctgaggaaccaggaggagatttggagatgaggccagtggagcccccttcgctttcagctctctttgggaccctcctgagaggtgtttgggaattgcaatctaacactggctttaaacattcagcatggtgtctgggggtcacctgtccttgtctatgatgtttacatccggggctcactattgaaacactgtatgagggtttgttttttccggttttcaacgtgttctttttctttttctttctctatccagctctttctgcatgaaacaggagcctagctagagctccgggtataagtgcaggtagaaaggccctgagaccccgctgcagtgcaaggggctggggataactctagccccttcgcagcagaagccctttgtgacaaagctgggctctccactctgcaggaaggaaagggcctgattccacaacccccatctgccctgaatgatttgggaggacaaaagctaccctagaccttcagacttgtggggggggggggaggaaaggataccctggaacctcagcgcttcaaaggttctcctgctgagtaaaacaggctggaagatctccttctcagagacagggagagaaactgggactccaaaacaaagtatggtctctagactgtcataattcccctgctccagcctcacctatccctgagccaaggccaagcactctgtaactagatccccagaactgagctatgggtgaggggagctgctggcctgttttgaggcttggctgcacagggaagaaagaagagtaagcgaggcggaggaggatctgcactctgtaaccacgactctcctcttgaatgaatgaagttatccatatgtctgtctttcttgaatttccttaatgtatcaccacaggaagagaccccccccccaaaaaaaatgcctccttgaggagtctgaagggtgggagaagaaacctctcagattctcagactgtagttgctgctcttgaaggacagaaaaccagcacttcttccccatcctctccaccacccaccaactccatcagaacttagctagggtgtctcttctcagagactggtggtcagctcttgtaaagcttttaaggccccaagccctgccaggtttaccttgagaaacctaggttttctgaattgtgaatgaagttgctctacgcctgttatagaatctgtccagcctcattcccagtgaattcaactccgccttcccctacaatctttgcctcttcttttgagctttaagccccacccccaacctttagcaagatgcacaacatcccaaaggctcatgattccttccccaagtccaatggctttcctttagagaaggtctccaggaactggacctcgaagggcatctcacaaggacctttgagcctcgccccaactgacctcggttggtgtgttaaatattatttcctgtgctaacagttgccgtttatgttttgttttgattttgtaaaataacacttccctgtatatattagcttcatagtgaaaataaatatccagatccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]