GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-01-09 02:26:01, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001426139            1288 bp    mRNA    linear   ROD 05-MAY-2025
DEFINITION  Mus musculus B cell receptor associated protein 31 (Bcap31),
            transcript variant 3, mRNA.
ACCESSION   NM_001426139 XM_011247600
VERSION     NM_001426139.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1288)
  AUTHORS   Zhao,B., An,F., Hao,Z., Zhang,W. and Wang,B.
  TITLE     BAP31 Plays an Essential Role in Mouse B Cell Development via
            Regulation of BCR Signaling
  JOURNAL   Int J Mol Sci 25 (9), 4962 (2024)
   PUBMED   38732181
  REMARK    GeneRIF: BAP31 Plays an Essential Role in Mouse B Cell Development
            via Regulation of BCR Signaling.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1288)
  AUTHORS   Zhao,B., Sun,L., Yuan,Q., Hao,Z., An,F., Zhang,W., Zhu,X. and
            Wang,B.
  TITLE     BAP31 Knockout in Macrophages Affects CD4+T Cell Activation through
            Upregulation of MHC Class II Molecule
  JOURNAL   Int J Mol Sci 24 (17), 13476 (2023)
   PUBMED   37686286
  REMARK    GeneRIF: BAP31 Knockout in Macrophages Affects CD4[+]T Cell
            Activation through Upregulation of MHC Class II Molecule.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1288)
  AUTHORS   Wei,X., Li,L., Zhao,J., Huo,Y., Hu,X., Lu,J., Pi,J., Zhang,W.,
            Xu,L., Yao,Y. and Xu,J.
  TITLE     BAP31 depletion inhibited adipogenesis, repressed lipolysis and
            promoted lipid droplets abnormal growth via attenuating Perilipin1
            proteasomal degradation
  JOURNAL   Int J Biol Sci 19 (6), 1713-1730 (2023)
   PUBMED   37063427
  REMARK    GeneRIF: BAP31 depletion inhibited adipogenesis, repressed
            lipolysis and promoted lipid droplets abnormal growth via
            attenuating Perilipin1 proteasomal degradation.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1288)
  AUTHORS   Li,G., Jiang,X., Liang,X., Hou,Y., Zang,J., Zhu,B., Jia,C., Niu,K.,
            Liu,X., Xu,X., Jiang,R. and Wang,B.
  TITLE     BAP31 regulates the expression of ICAM-1/VCAM-1 via MyD88/NF-kappaB
            pathway in acute lung injury mice model
  JOURNAL   Life Sci 313, 121310 (2023)
   PUBMED   36549351
  REMARK    GeneRIF: BAP31 regulates the expression of ICAM-1/VCAM-1 via
            MyD88/NF-kappaB pathway in acute lung injury mice model.
REFERENCE   5  (bases 1 to 1288)
  AUTHORS   Li,G.X., Jiang,X.H., Zang,J.N., Zhu,B.Z., Jia,C.C., Niu,K.W.,
            Liu,X., Jiang,R. and Wang,B.
  TITLE     B-cell receptor associated protein 31 deficiency decreases the
            expression of adhesion molecule CD11b/CD18 and PSGL-1 in
            neutrophils to ameliorate acute lung injury
  JOURNAL   Int J Biochem Cell Biol 152, 106299 (2022)
   PUBMED   36210579
  REMARK    GeneRIF: B-cell receptor associated protein 31 deficiency decreases
            the expression of adhesion molecule CD11b/CD18 and PSGL-1 in
            neutrophils to ameliorate acute lung injury.
REFERENCE   6  (bases 1 to 1288)
  AUTHORS   Pang,A.L., Taylor,H.C., Johnson,W., Alexander,S., Chen,Y., Su,Y.A.,
            Li,X., Ravindranath,N., Dym,M., Rennert,O.M. and Chan,W.Y.
  TITLE     Identification of differentially expressed genes in mouse
            spermatogenesis
  JOURNAL   J Androl 24 (6), 899-911 (2003)
   PUBMED   14581517
REFERENCE   7  (bases 1 to 1288)
  AUTHORS   Schamel,W.W., Kuppig,S., Becker,B., Gimborn,K., Hauri,H.P. and
            Reth,M.
  TITLE     A high-molecular-weight complex of membrane proteins BAP29/BAP31 is
            involved in the retention of membrane-bound IgD in the endoplasmic
            reticulum
  JOURNAL   Proc Natl Acad Sci U S A 100 (17), 9861-9866 (2003)
   PUBMED   12886015
  REMARK    GeneRIF: A high-molecular-weight complex of membrane proteins
            BAP29/BAP31 is involved in the retention of membrane-bound IgD in
            the endoplasmic reticulum.
REFERENCE   8  (bases 1 to 1288)
  AUTHORS   Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N.,
            Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N.,
            Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R.,
            Thomas,D.Y., Rowley,A. and Bergeron,J.J.
  TITLE     Proteomics characterization of abundant Golgi membrane proteins
  JOURNAL   J Biol Chem 276 (7), 5152-5165 (2001)
   PUBMED   11042173
REFERENCE   9  (bases 1 to 1288)
  AUTHORS   Adachi,T., Schamel,W.W., Kim,K.M., Watanabe,T., Becker,B.,
            Nielsen,P.J. and Reth,M.
  TITLE     The specificity of association of the IgD molecule with the
            accessory proteins BAP31/BAP29 lies in the IgD transmembrane
            sequence
  JOURNAL   EMBO J 15 (7), 1534-1541 (1996)
   PUBMED   8612576
REFERENCE   10 (bases 1 to 1288)
  AUTHORS   Kim,K.M., Adachi,T., Nielsen,P.J., Terashima,M., Lamers,M.C.,
            Kohler,G. and Reth,M.
  TITLE     Two new proteins preferentially associated with membrane
            immunoglobulin D
  JOURNAL   EMBO J 13 (16), 3793-3800 (1994)
   PUBMED   8070407
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL805924.5.
            
            On Dec 6, 2023 this sequence version replaced XM_011247600.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR17784650.469928.1,
                                           SRR17253013.1376645.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164142
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-130               AL805924.5         203224-203353       c
            131-266             AL805924.5         201685-201820       c
            267-367             AL805924.5         199337-199437       c
            368-515             AL805924.5         193889-194036       c
            516-651             AL805924.5         176439-176574       c
            652-772             AL805924.5         175552-175672       c
            773-873             AL805924.5         174729-174829       c
            874-1288            AL805924.5         173073-173487       c
FEATURES             Location/Qualifiers
     source          1..1288
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 37.38 cM"
     gene            1..1288
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="B cell receptor associated protein 31"
                     /db_xref="GeneID:27061"
                     /db_xref="MGI:MGI:1350933"
     exon            1..130
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            131..266
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     CDS             175..912
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="isoform a is encoded by transcript variant 3;
                     accessory protein BAP31; p28; BCR-associated protein 31"
                     /codon_start=1
                     /product="B-cell receptor-associated protein 31 isoform a"
                     /protein_id="NP_001413068.1"
                     /db_xref="GeneID:27061"
                     /db_xref="MGI:MGI:1350933"
                     /translation="
MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSVKKEE"
     misc_feature    193..255
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     transmembrane region"
     misc_feature    304..366
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     transmembrane region"
     misc_feature    481..543
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     transmembrane region"
     misc_feature    664..669
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="Cleavage, by caspase-8. /evidence=ECO:0000255;
                     propagated from UniProtKB/Swiss-Prot (Q61335.4); cleavage
                     site"
     misc_feature    898..909
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61335.4);
                     Region: Di-lysine motif"
     exon            267..367
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            368..515
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            516..651
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            652..772
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            773..873
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     exon            874..1288
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1270..1275
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="hexamer: AATAAA"
     polyA_site      1288
                     /gene="Bcap31"
                     /gene_synonym="Bap31"
                     /note="major polyA site"
ORIGIN      
ctctccgacaacagaaacgaagcaagtccgcgtacactacagaagcggccccagccctcccgccaaggcgcctccaagctccacccctgcgtgtccgaagtgtcagaggcgcggcagggggccttcaaccgaaacaagctcccatccctctgttggaaccctttaagtcacaggatgagtttgcagtggactacagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctccaaaaagatggcagaaggtttttaaatcccggctggtggagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtactgttggttattgatgctgtacgagagatcctgaaatacgatgatgtgacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcggccaagaaatacatggaggagaatgatcagctaaagaagggagctgccgaggatggagacaagttggatattgggaatactgaaatgaagttagaggagaacaagagcctgaagaatgacctgaggaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgcctgctagaagaacatgccaaactgcaggcatcagtacgtggtccctcagtcaagaaggaggagtaaaggcttggtgtttccctgcctgccgctggcttctacctgacccatgcttactgcttccttggagcccagactatccctctggtacttgggtttattccctacttccccaattttcttccatggcttatagatcattattttggcaccattacacatactgctcttataccaaaagggacctgattgttgtttattcagagtacttttgccactgttctgcctggctagggcactttccactcctggaagtgtagaaaagcactggtgacctggcctgcagtttgaacccctttttattttgcaatgtaccctaaaggaggctgctgtgaagcaggtcaactgttttatcctgaggggaataaatgttgttatgtta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]