2025-04-20 02:26:20, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001424959 1461 bp mRNA linear ROD 01-JUL-2024 DEFINITION Mus musculus TGFB-induced factor homeobox 1 (Tgif1), transcript variant 6, mRNA. ACCESSION NM_001424959 XM_011246363 VERSION NM_001424959.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1461) AUTHORS Chang,Y.H., Tseng,Y.H., Wang,J.M., Tsai,Y.S. and Huang,H.S. TITLE TG-interacting factor 1 regulates mitotic clonal expansion during adipocyte differentiation JOURNAL Biochim Biophys Acta Mol Cell Biol Lipids 1869 (5), 159492 (2024) PUBMED 38575107 REMARK GeneRIF: TG-interacting factor 1 regulates mitotic clonal expansion during adipocyte differentiation. REFERENCE 2 (bases 1 to 1461) AUTHORS Cong,M., Li,J., Wang,L., Liu,C., Zheng,M., Zhou,Q., Du,M., Ye,X., Feng,M., Ye,Y., Zhang,S., Xu,W., Lu,Y., Wang,C., Xia,Y., Xie,H., Zhang,Y., He,Q., Gong,L., Gu,Y., Sun,H., Zhang,Q., Zhao,J., Ding,F., Gu,X. and Zhou,S. TITLE MircoRNA-25-3p in skin precursor cell-induced Schwann cell-derived extracellular vesicles promotes axon regeneration by targeting Tgif1 JOURNAL Exp Neurol 376, 114750 (2024) PUBMED 38492636 REMARK GeneRIF: MircoRNA-25-3p in skin precursor cell-induced Schwann cell-derived extracellular vesicles promotes axon regeneration by targeting Tgif1. REFERENCE 3 (bases 1 to 1461) AUTHORS Bolamperti,S., Saito,H., Heerdmann,S., Hesse,E. and Taipaleenmaki,H. TITLE Tgif1-deficiency impairs cytoskeletal architecture in osteoblasts by activating PAK3 signaling JOURNAL Elife 13, 94265 (2024) PUBMED 38661167 REMARK GeneRIF: Tgif1-deficiency impairs cytoskeletal architecture in osteoblasts by activating PAK3 signaling. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1461) AUTHORS Taipaleenmaki,H., Saito,H., Schroder,S., Maeda,M., Mettler,R., Ring,M., Rollmann,E., Gasser,A., Haasper,C., Gehrke,T., Weiss,A., Grimm,S.K. and Hesse,E. TITLE Antagonizing microRNA-19a/b augments PTH anabolic action and restores bone mass in osteoporosis in mice JOURNAL EMBO Mol Med 14 (11), e13617 (2022) PUBMED 36193848 REFERENCE 5 (bases 1 to 1461) AUTHORS Astanina,E., Doronzo,G., Cora,D., Neri,F., Oliviero,S., Genova,T., Mussano,F., Middonti,E., Vallariello,E., Cencioni,C., Valdembri,D., Serini,G., Limana,F., Foglio,E., Ballabio,A. and Bussolino,F. TITLE The TFEB-TGIF1 axis regulates EMT in mouse epicardial cells JOURNAL Nat Commun 13 (1), 5191 (2022) PUBMED 36057632 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1461) AUTHORS Zhang,X., Friedman,A., Heaney,S., Purcell,P. and Maas,R.L. TITLE Meis homeoproteins directly regulate Pax6 during vertebrate lens morphogenesis JOURNAL Genes Dev 16 (16), 2097-2107 (2002) PUBMED 12183364 REFERENCE 7 (bases 1 to 1461) AUTHORS Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S. TITLE Construction of long-transcript enriched cDNA libraries from submicrogram amounts of total RNAs by a universal PCR amplification method JOURNAL Genome Res 11 (9), 1553-1558 (2001) PUBMED 11544199 REFERENCE 8 (bases 1 to 1461) AUTHORS Melhuish,T.A. and Wotton,D. TITLE The interaction of the carboxyl terminus-binding protein with the Smad corepressor TGIF is disrupted by a holoprosencephaly mutation in TGIF JOURNAL J Biol Chem 275 (50), 39762-39766 (2000) PUBMED 10995736 REFERENCE 9 (bases 1 to 1461) AUTHORS Lee,C.K., Klopp,R.G., Weindruch,R. and Prolla,T.A. TITLE Gene expression profile of aging and its retardation by caloric restriction JOURNAL Science 285 (5432), 1390-1393 (1999) PUBMED 10464095 REFERENCE 10 (bases 1 to 1461) AUTHORS Bertolino,E., Wildt,S., Richards,G. and Clerc,R.G. TITLE Expression of a novel murine homeobox gene in the developing cerebellar external granular layer during its proliferation JOURNAL Dev Dyn 205 (4), 410-420 (1996) PUBMED 8901052 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC079441.37. On Oct 17, 2023 this sequence version replaced XM_011246363.4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR14777530.755739.1, SRR17253014.5082857.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-172 AC079441.37 221571-221742 c 173-399 AC079441.37 218108-218334 c 400-1461 AC079441.37 216147-217208 c FEATURES Location/Qualifiers source 1..1461 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="17" /map="17 41.87 cM" gene 1..1461 /gene="Tgif1" /gene_synonym="Tgif" /note="TGFB-induced factor homeobox 1" /db_xref="GeneID:21815" /db_xref="MGI:MGI:1194497" exon 1..172 /gene="Tgif1" /gene_synonym="Tgif" /inference="alignment:Splign:2.1.0" misc_feature 121..123 /gene="Tgif1" /gene_synonym="Tgif" /note="upstream in-frame stop codon" CDS 148..975 /gene="Tgif1" /gene_synonym="Tgif" /note="isoform d is encoded by transcript variant 6; homeobox protein TGIF1; 5'-TG-3'-interacting factor 1; TALE family homeobox; TG interacting factor 1" /codon_start=1 /product="homeobox protein TGIF1 isoform d" /protein_id="NP_001411888.1" /db_xref="GeneID:21815" /db_xref="MGI:MGI:1194497" /translation="
MKTPGTWLSLVAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA"
misc_feature order(262..276,280..282,340..342,358..360,397..399, 403..408,415..420,424..432) /gene="Tgif1" /gene_synonym="Tgif" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(268..270,277..279,406..408,415..420,427..429) /gene="Tgif1" /gene_synonym="Tgif" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 316..432 /gene="Tgif1" /gene_synonym="Tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" exon 173..399 /gene="Tgif1" /gene_synonym="Tgif" /inference="alignment:Splign:2.1.0" exon 400..1461 /gene="Tgif1" /gene_synonym="Tgif" /inference="alignment:Splign:2.1.0" regulatory 1437..1442 /regulatory_class="polyA_signal_sequence" /gene="Tgif1" /gene_synonym="Tgif" /note="hexamer: AATAAA" polyA_site 1461 /gene="Tgif1" /gene_synonym="Tgif" /note="major polyA site" ORIGIN
agacctagaccgcgactgcagttccaacggaacacggttatagcagctgccgccaaacacgcttcctcacggggtttctccgcgcttcctaccttagagagttgggtggatgttattctgtgagagaccccgaaacatacggaactcatgaagaccccgggtacttggttaagtcttgttgcagcatctggcagtgactctgaggatgaagacagcatggacagtcccctggacctttcctcatcagcagcctctggcaagagaaggaggagaggcaatctgcccaaggagtcagtccagattctgcgagactggctgtatgaacacagatacaacgcctatccctcagagcaagagaaagcactgctgtcccagcagacacacctgtccacactacaggtctgtaactggttcatcaacgcccgccgcaggctccttcctgacatgctgagaaaggatggcaaagatccaaatcagttcacgatttcccgccgtggggccaagatttcagaagctagctctattgaagctgcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgtagttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccaggatccattttggctcgcccgtcagtgatctgccataccactgtgactgcattgaaggatgggcctttctctctctgtcagccgattggtgtgggacagagtacagatgtaccgcaaatagcacccagcaactttacagacacctctctcgtgtacccagaggacacttgcaaatctggacccagtccaaaccctcagagtggtcttttcaacactcctccccctactccaccagacctcaaccaggattttagtggattccagcttctagtggatgttgcactcaaacgagcggcagagatggagcttcaggccaaactcacagcttaaccgttttttcaaacaaaacagttctccaaaatacggtcctgattgccgggggtgatggcaagagatgcattattttatatatttttctattaatatttgcacatgggattgctcagacgaagcttcctgttactaagatgtcttaagtggaatagagtcattccaagaactacaaactaaagctactgtagaaacaaagggttttcttttcgaatgtttcttggtagtttctcataatgtgagacggttcccagtatcatgtgatcttctcctccagactcctcttctttatgttccaagactgtgcaatactttagacgccctcgcacctctctcttcccatgtggaatgggacgcccacctacagtctaatgagtaaactttcagttttttgtttgtttgtttttttttagattcaagcaagtatgaatctagttgttggataccttttttcatgatgtaataaagtattttctttaaaagtta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]