2025-04-20 02:26:32, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001424689 3143 bp mRNA linear ROD 13-MAY-2024 DEFINITION Mus musculus Pbx/knotted 1 homeobox 2 (Pknox2), transcript variant 7, mRNA. ACCESSION NM_001424689 XM_011242440 VERSION NM_001424689.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 3143) AUTHORS Chen,L., Li,H., Liu,X., Zhang,N., Wang,K., Shi,A., Gao,H., Akdis,D., Saguner,A.M., Xu,X., Osto,E., Van de Veen,W., Li,G., Bayes-Genis,A., Duru,F., Song,J., Li,X. and Hu,S. TITLE PBX/Knotted 1 homeobox-2 (PKNOX2) is a novel regulator of myocardial fibrosis JOURNAL Signal Transduct Target Ther 9 (1), 94 (2024) PUBMED 38644381 REMARK GeneRIF: PBX/Knotted 1 homeobox-2 (PKNOX2) is a novel regulator of myocardial fibrosis. Publication Status: Online-Only REFERENCE 2 (bases 1 to 3143) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 3 (bases 1 to 3143) AUTHORS Trigila,A.P., Castagna,V.C., Berasain,L., Montini,D., Rubinstein,M., Gomez-Casati,M.E. and Franchini,L.F. TITLE Accelerated Evolution Analysis Uncovers PKNOX2 as a Key Transcription Factor in the Mammalian Cochlea JOURNAL Mol Biol Evol 40 (7) (2023) PUBMED 37247388 REMARK GeneRIF: Accelerated Evolution Analysis Uncovers PKNOX2 as a Key Transcription Factor in the Mammalian Cochlea. REFERENCE 4 (bases 1 to 3143) AUTHORS Miyake,Y., Obana,M., Nakae,T., Yamamoto,A., Tanaka,S., Maeda,M., Okada,Y. and Fujio,Y. TITLE PKNOX2 regulates myofibroblast functions and tubular cell survival during kidney fibrosis JOURNAL Biochem Biophys Res Commun 571, 88-95 (2021) PUBMED 34311199 REMARK GeneRIF: PKNOX2 regulates myofibroblast functions and tubular cell survival during kidney fibrosis. REFERENCE 5 (bases 1 to 3143) AUTHORS Lopez-Gonzalez,L., Alonso,A., Garcia-Calero,E., de Puelles,E. and Puelles,L. TITLE Tangential Intrahypothalamic Migration of the Mouse Ventral Premamillary Nucleus and Fgf8 Signaling JOURNAL Front Cell Dev Biol 9, 676121 (2021) PUBMED 34095148 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 3143) AUTHORS Zhang,X., Rowan,S., Yue,Y., Heaney,S., Pan,Y., Brendolan,A., Selleri,L. and Maas,R.L. TITLE Pax6 is regulated by Meis and Pbx homeoproteins during pancreatic development JOURNAL Dev Biol 300 (2), 748-757 (2006) PUBMED 17049510 REFERENCE 7 (bases 1 to 3143) AUTHORS Ferretti,E., Villaescusa,J.C., Di Rosa,P., Fernandez-Diaz,L.C., Longobardi,E., Mazzieri,R., Miccio,A., Micali,N., Selleri,L., Ferrari,G. and Blasi,F. TITLE Hypomorphic mutation of the TALE gene Prep1 (pKnox1) causes a major reduction of Pbx and Meis proteins and a pleiotropic embryonic phenotype JOURNAL Mol Cell Biol 26 (15), 5650-5662 (2006) PUBMED 16847320 REFERENCE 8 (bases 1 to 3143) AUTHORS Mulligan,M.K., Ponomarev,I., Hitzemann,R.J., Belknap,J.K., Tabakoff,B., Harris,R.A., Crabbe,J.C., Blednov,Y.A., Grahame,N.J., Phillips,T.J., Finn,D.A., Hoffman,P.L., Iyer,V.R., Koob,G.F. and Bergeson,S.E. TITLE Toward understanding the genetics of alcohol drinking through transcriptome meta-analysis JOURNAL Proc Natl Acad Sci U S A 103 (16), 6368-6373 (2006) PUBMED 16618939 REFERENCE 9 (bases 1 to 3143) AUTHORS Haller,K., Rambaldi,I., Daniels,E. and Featherstone,M. TITLE Subcellular localization of multiple PREP2 isoforms is regulated by actin, tubulin, and nuclear export JOURNAL J Biol Chem 279 (47), 49384-49394 (2004) PUBMED 15339927 REMARK GeneRIF: transcriptional regulation by PREP2 is modulated through the subcellular distribution of multiple isoforms and by interaction with two distinct cytoskeletal systems REFERENCE 10 (bases 1 to 3143) AUTHORS Haller,K., Rambaldi,I., Kovacs,E.N., Daniels,E. and Featherstone,M. TITLE Prep2: cloning and expression of a new prep family member JOURNAL Dev Dyn 225 (3), 358-364 (2002) PUBMED 12412021 REMARK GeneRIF: Prep2 functions to varying degrees in a broad array of tissues and developmental processes. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC164087.5 and CT009699.13. On Oct 4, 2023 this sequence version replaced XM_011242440.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR7345562.2138183.1, SRR12282455.24546372.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131, SAMN01164139 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-26 AC164087.5 198302-198327 c 27-96 AC164087.5 134268-134337 c 97-201 CT009699.13 158945-159049 c 202-310 CT009699.13 140155-140263 c 311-450 CT009699.13 126470-126609 c 451-622 CT009699.13 108098-108269 c 623-811 CT009699.13 95361-95549 c 812-888 CT009699.13 67088-67164 c 889-1067 CT009699.13 66097-66275 c 1068-3143 CT009699.13 62759-64834 c FEATURES Location/Qualifiers source 1..3143 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="9" /map="9 20.7 cM" gene 1..3143 /gene="Pknox2" /gene_synonym="D230005H23Rik; Prep2" /note="Pbx/knotted 1 homeobox 2" /db_xref="GeneID:208076" /db_xref="MGI:MGI:2445415" misc_feature 212..214 /gene="Pknox2" /gene_synonym="D230005H23Rik; Prep2" /note="upstream in-frame stop codon" CDS 224..1300 /gene="Pknox2" /gene_synonym="D230005H23Rik; Prep2" /note="isoform 3 is encoded by transcript variant 7; homeobox protein PKNOX2; PBX/knotted homeobox 2; homeobox protein PREP-2; homeodomain containing transcription factor PREP2" /codon_start=1 /product="homeobox protein PKNOX2 isoform 3" /protein_id="NP_001411618.1" /db_xref="GeneID:208076" /db_xref="MGI:MGI:2445415" /translation="
MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSATASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGTPGTNPDGSINLDNLQSLSSDNATMAMQQAMMAAHDDSLDGTEEEDEDDMEEEEEEEEELEEEADELQTTNVSDLGLEHSDSLE"
misc_feature 224..349 /gene="Pknox2" /gene_synonym="D230005H23Rik; Prep2" /note="propagated from UniProtKB/Swiss-Prot (Q8BG99.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" regulatory 3120..3125 /regulatory_class="polyA_signal_sequence" /gene="Pknox2" /gene_synonym="D230005H23Rik; Prep2" /note="hexamer: AGTAAA" polyA_site 3143 /gene="Pknox2" /gene_synonym="D230005H23Rik; Prep2" /note="major polyA site" ORIGIN
gtcagtctgatgaagattggcatcaggtgaacctagaagaagactttaaggggttctggttttccatgctgctcactagaaaagaagccctgaactgtactctctctatagctgactagaggtgtttctggcccagctggaagtgagaagagggggcagaccccctgaagaccatcccagaggcagtgggatcctccaacaatcctccatgtgaatcaatcccatgatgcaacatgcctccccagccccagctctgacaatgatggccacgcagaatgtccctcccccaccctaccaggacagcccccagatgacagcaactgcccagccaccttccaaggcccaggctgtccacatctcagcaccctcagctaccgccagcacacctgtgcccagtgcccccattgatccccaagcccagctggaggctgacaagcgagctgtgtacaggcaccctcttttcccgctcctgacgctgctgtttgagaaatgtgaacaggccacccagggctccgagtgcatcacctccgccagctttgatgtggacatcgagaactttgtccaccagcaggagcaggaacacaaacccttcttcagcgatgacccagaactggacaatctgatggtgaaggcaatccaggtcctgaggatccacctgctagagttggagaaagtcaatgagctctgcaaggacttttgcaaccgttacatcacctgcctcaaaaccaagatgcacagtgataacctgctcaggaatgacctcggggggccctactcccccaaccagccctccataaaccttcactcacagcacccctatcccactgaagatgagaagaggcagattgccgcgcagacaaacctcacccttctgcaagtaaacaactggttcatcaatgccaggaggcgcatcctgcagcccatgcttgatgccagcaacccagatcctgctcccaaagccaagaaaatcaagtctcagcaccggcccacccaaagattctggcccaattccattgctgctggggttctgcaacagcagggtggcaccccagggacgaaccctgatggttccatcaacttggacaacctgcagtccctgtcctcagacaatgccaccatggccatgcagcaggcaatgatggctgcacatgatgattcattggatggcacggaagaagaggatgaagatgatatggaggaggaggaagaggaggaggaggagctagaggaggaggctgatgagctacagacaacgaatgtcagcgacctgggcttggaacacagtgactccctggagtagtcaggcagcccagattgcgctggtcaccgagcaggaaaggagtgtcatcaggagggttcagggtggggggaggagatatgggcaggcagcactaagaaagttgggccctagcttccccgaatcatagcttgaagaaatgcagaggagacaccctgctcctttccaaccaccaagcttcagtgaaaacctagtcccagaccctcagactacagagcactccattgctggggccagccaaacagcctgagaagaaagacagcgtgagatctggactcaccgaataccagagatgacacccatggctccgcatggaaaaagacttgatttgtttacaagccactgccctgtgaggtggacaggcgctgcttgcagagcgaacctttgctaaggggcagacttgggagggaaggatgagaaagaaggggtctaacattttcccccaggagaatctgagctcccttgaaagacactcacggacagaaaggagcccaaatgcataaccagtggccagaggagtgggagggcctgagacaacaccacacccttcatatcagagtggaacgtggactgcacagggctccaacttaccctaccaggaccctgtctcttggcacagcagccatggactataaggagagggggaaggaaaccaaagagactccttcttcctctcttggaaatacattgtaggtgggtccaacctgaagaggttaagagcaactctacatctgggtcagctcgaggaccaagcaggtagcagaacctggatcaggagccatattaagatgactttggggatcccagcagtccctacgtgatcacatagctcctgtcacaataggaccatagtgtcttattagatgttcctaccctcagatggagttcttcagagaccccagccccctccataaacctttaggggttctttccactccacaggtcttcgtggtatccctctgctcccaagctggcactaccagcttctggcctcctccttcattctattctccagagaaggcagaagaaacattggaaagaagcattgtcccaatgggaagccagggtctgaagaaggtgctactgctcttaccttcaggactcaacatggcaggggatatagcgcccagctgatccacacacaccatgcttggcatctgctcctcctgtcccctcccaccctgtggctgtgaaagacaggactgaccacacgtgtgttttccgttgggtttaatgtgatgggtgtgcagttccttcatttgtaagtgtgcattggccatctccttcagtgctaggatgtgaatggctatctggctcaaccagagggcactcttgcgaccttctgagccttctcctcctctacctggttgggtggagcaaaaggatagtcacttttctgaggtctcccggaaatgaatgtatttctcccccaaaagagctgatatttaatgttttactagggatttttgagaaacaaataaccttatttataatctgggcgatccaatcatttttttactcccttttgatgccatacctagaggaaaggcaagctttttggcgtgagacttttgcaacccacaatgggataaaacatttcctcttctggttcatttttcttgttaaagtacatacatccacacataaattcctccactcagcaccgtgacaagctcccttcttcagcacggacatgtgtgcatacgtgcacatggatacacatgtctacatctccctcctagccccttccacctgcctaatgttacgcaacctccttctgatgtatccaccaaaccagtactgaatgtggccacgagttttcagtaaaccttatcacctaccgaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]