GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-01-31 08:21:12, GGRNA.v2 : RefSeq release 227 (Nov, 2024)

LOCUS       NM_001417315             837 bp    mRNA    linear   ROD 28-AUG-2024
DEFINITION  Mus musculus SWA-70 protein (Swap70), transcript variant 2, mRNA.
ACCESSION   NM_001417315
VERSION     NM_001417315.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 837)
  AUTHORS   Chang,C.Y., Pearce,G., Betaneli,V., Kapustsenka,T., Hosseini,K.,
            Fischer-Friedrich,E., Corbeil,D., Karbanova,J., Taubenberger,A.,
            Dahncke,B., Rauner,M., Furesi,G., Perner,S., Rost,F. and
            Jessberger,R.
  TITLE     The F-actin bundler SWAP-70 promotes tumor metastasis
  JOURNAL   Life Sci Alliance 7 (8), e202302307 (2024)
   PUBMED   38760173
  REMARK    GeneRIF: The F-actin bundler SWAP-70 promotes tumor metastasis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 837)
  AUTHORS   Qian,Q., Hu,F., Yu,W., Leng,D., Li,Y., Shi,H., Deng,D., Ding,K.,
            Liang,C. and Liu,J.
  TITLE     SWAP70 Overexpression Protects Against Pathological Cardiac
            Hypertrophy in a TAK1-Dependent Manner
  JOURNAL   J Am Heart Assoc 12 (7), e028628 (2023)
   PUBMED   36974751
  REMARK    GeneRIF: SWAP70 Overexpression Protects Against Pathological
            Cardiac Hypertrophy in a TAK1-Dependent Manner.
REFERENCE   3  (bases 1 to 837)
  AUTHORS   Chen,Z., Flores Castro,D., Gupta,S., Phalke,S., Manni,M.,
            Rivera-Correa,J., Jessberger,R., Zaghouani,H., Giannopoulou,E.,
            Pannellini,T. and Pernis,A.B.
  TITLE     Interleukin-13 Receptor alpha1-Mediated Signaling Regulates
            Age-Associated/Autoimmune B Cell Expansion and Lupus Pathogenesis
  JOURNAL   Arthritis Rheumatol 74 (9), 1544-1555 (2022)
   PUBMED   35438841
REFERENCE   4  (bases 1 to 837)
  AUTHORS   Dohnke,S., Moehser,S., Surnov,A., Kurth,T., Jessberger,R.,
            Kretschmer,K. and Garbe,A.I.
  TITLE     Role of Dynamic Actin Cytoskeleton Remodeling in Foxp3+ Regulatory
            T Cell Development and Function: Implications for
            Osteoclastogenesis
  JOURNAL   Front Immunol 13, 836646 (2022)
   PUBMED   35359955
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 837)
  AUTHORS   Ricker,E., Manni,M., Flores-Castro,D., Jenkins,D., Gupta,S.,
            Rivera-Correa,J., Meng,W., Rosenfeld,A.M., Pannellini,T., Bachu,M.,
            Chinenov,Y., Sculco,P.K., Jessberger,R., Prak,E.T.L. and
            Pernis,A.B.
  TITLE     Altered function and differentiation of age-associated B cells
            contribute to the female bias in lupus mice
  JOURNAL   Nat Commun 12 (1), 4813 (2021)
   PUBMED   34376664
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 837)
  AUTHORS   Gross,B., Borggrefe,T., Wabl,M., Sivalenka,R.R., Bennett,M.,
            Rossi,A.B. and Jessberger,R.
  TITLE     SWAP-70-deficient mast cells are impaired in development and
            IgE-mediated degranulation
  JOURNAL   Eur J Immunol 32 (4), 1121-1128 (2002)
   PUBMED   11920580
  REMARK    GeneRIF: In mast cells SWAP-70 plays a role both in establishing
            the initial competence to degranulate and to develop into mature
            mast cells.
REFERENCE   7  (bases 1 to 837)
  AUTHORS   Borggrefe,T., Keshavarzi,S., Gross,B., Wabl,M. and Jessberger,R.
  TITLE     Impaired IgE response in SWAP-70-deficient mice
  JOURNAL   Eur J Immunol 31 (8), 2467-2475 (2001)
   PUBMED   11500831
  REMARK    GeneRIF: SWAP-70 deficient mice exhibit B cell anomalies including
            increased autoantibody production and impaired isotype switching.
REFERENCE   8  (bases 1 to 837)
  AUTHORS   Masat,L., Liddell,R.A., Mock,B.A., Kuo,W.L., Jessberger,R., Wabl,M.
            and Morse,H.C. 3rd.
  TITLE     Mapping of the SWAP70 gene to mouse chromosome 7 and human
            chromosome 11p15
  JOURNAL   Immunogenetics 51 (1), 16-19 (2000)
   PUBMED   10663557
REFERENCE   9  (bases 1 to 837)
  AUTHORS   Borggrefe,T., Masat,L., Wabl,M., Riwar,B., Cattoretti,G. and
            Jessberger,R.
  TITLE     Cellular, intracellular, and developmental expression patterns of
            murine SWAP-70
  JOURNAL   Eur J Immunol 29 (6), 1812-1822 (1999)
   PUBMED   10382743
REFERENCE   10 (bases 1 to 837)
  AUTHORS   Borggrefe,T., Wabl,M., Akhmedov,A.T. and Jessberger,R.
  TITLE     A B-cell-specific DNA recombination complex
  JOURNAL   J Biol Chem 273 (27), 17025-17035 (1998)
   PUBMED   9642267
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC147244.2 and AC124472.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CJ135859.1, BY754522.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849380
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-158               AC147244.2         851-1008            c
            159-299             AC124472.4         151256-151396       c
            300-473             AC124472.4         138872-139045       c
            474-837             AC124472.4         130537-130900       c
FEATURES             Location/Qualifiers
     source          1..837
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="7"
                     /map="7 57.7 cM"
     gene            1..837
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /note="SWA-70 protein"
                     /db_xref="GeneID:20947"
                     /db_xref="MGI:MGI:1298390"
     exon            1..158
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    39..41
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /note="upstream in-frame stop codon"
     CDS             60..716
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /note="isoform 2 is encoded by transcript variant 2;
                     switch-associated protein 70; SWAP-70; SWAP complex
                     protein, 70 kDa"
                     /codon_start=1
                     /product="switch-associated protein 70 isoform 2"
                     /protein_id="NP_001404244.1"
                     /db_xref="GeneID:20947"
                     /db_xref="MGI:MGI:1298390"
                     /translation="
MRGLKDELLKAIWHAFTALDLDRSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKSPLLITEDDAFKVWVIFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDNKDGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQVRGP"
     exon            159..299
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /inference="alignment:Splign:2.1.0"
     exon            300..473
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /inference="alignment:Splign:2.1.0"
     exon            474..837
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /inference="alignment:Splign:2.1.0"
     regulatory      814..819
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /note="hexamer: AATAAA"
     polyA_site      837
                     /gene="Swap70"
                     /gene_synonym="70kDa"
                     /note="major polyA site"
ORIGIN      
agaggcgctgagttgccgactgggctgaccaggtctgttagggcagcgcggccgcggccatgaggggcttgaaagacgaactgctcaaagccatttggcacgccttcaccgcgctcgacctggaccgcagcggcaaggtctccaagtcgcaactcaaggtcctttcccataacctgtgcacggtgctgaaggttccacatgacccggttgcccttgaggagcactttagggatgacgatgaggggcctgtctccaatcagggctacatgccatatttaaacaagttcattttggaaaaggtccaagacaactttgacaagattgaattcaatagaatgtgttggacactttgtgtcaagaaaaacctcacaaagagtcctctactcattacagaagatgatgcatttaaagtgtgggtcattttcaactttttgtcagaggacaagtatccactaattattgtgccagaagagattgaatacctgcttaagaagcttacagaagctatgggaggaggttggcaacaagaacaatttgaacattacaaaataaactttgatgacaataaagatggcctttctgcatgggaacttattgagctaattgggaatggacagtttagcaagggcatggaccgtcagaccgtatctatggccattaacgaagtcttcaatgagcttattttagatgtattgaagcaggtaagagggccatagcactttctctctcatctttagattctgatgtttgagaccaaatagcttccttccctctccataagtcacttatactctttaaatgatttagaacaaaaataaagttttctgttttctctgt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]