ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-01-31 08:13:04, GGRNA.v2 : RefSeq release 227 (Nov, 2024)
LOCUS NM_001252261 1307 bp mRNA linear ROD 10-OCT-2024
DEFINITION Mus musculus nucleophosmin 1 (Npm1), transcript variant 3, mRNA.
ACCESSION NM_001252261
VERSION NM_001252261.1
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1307)
AUTHORS Zhang,S., Zhang,Y., Duan,X., Wang,B. and Zhan,Z.
TITLE Targeting NPM1 Epigenetically Promotes Postinfarction Cardiac
Repair by Reprogramming Reparative Macrophage Metabolism
JOURNAL Circulation 149 (25), 1982-2001 (2024)
PUBMED 38390737
REMARK GeneRIF: Targeting NPM1 Epigenetically Promotes Postinfarction
Cardiac Repair by Reprogramming Reparative Macrophage Metabolism.
REFERENCE 2 (bases 1 to 1307)
AUTHORS Korai,A., Lin,X., Tago,K. and Funakoshi-Tago,M.
TITLE The acetylation of STAT3 at K685 attenuates NPM-ALK-induced
tumorigenesis
JOURNAL Cell Signal 114, 110985 (2024)
PUBMED 38000524
REMARK GeneRIF: The acetylation of STAT3 at K685 attenuates
NPM-ALK-induced tumorigenesis.
REFERENCE 3 (bases 1 to 1307)
AUTHORS Fang,Y., Zhang,J., Zhu,D., Mei,Q., Liao,T., Cheng,H., He,Y., Cao,Y.
and Wei,Z.
TITLE MANF Promotes Unexplained Recurrent Miscarriages by Interacting
with NPM1 and Downregulating Trophoblast Cell Migration and
Invasion
JOURNAL Int J Biol Sci 20 (1), 296-311 (2024)
PUBMED 38164189
REMARK GeneRIF: MANF Promotes Unexplained Recurrent Miscarriages by
Interacting with NPM1 and Downregulating Trophoblast Cell Migration
and Invasion.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1307)
AUTHORS Izzo,A., Akol,I., Villarreal,A., Lebel,S., Garcia-Miralles,M.,
Cheffer,A., Bovio,P., Heidrich,S. and Vogel,T.
TITLE Nucleophosmin 1 cooperates with the methyltransferase DOT1L to
preserve peri-nucleolar heterochromatin organization by regulating
H3K27me3 levels and DNA repeats expression
JOURNAL Epigenetics Chromatin 16 (1), 36 (2023)
PUBMED 37759327
REMARK GeneRIF: Nucleophosmin 1 cooperates with the methyltransferase
DOT1L to preserve peri-nucleolar heterochromatin organization by
regulating H3K27me3 levels and DNA repeats expression.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1307)
AUTHORS Lara-Astiaso,D., Goni-Salaverri,A., Mendieta-Esteban,J.,
Narayan,N., Del Valle,C., Gross,T., Giotopoulos,G., Beinortas,T.,
Navarro-Alonso,M., Aguado-Alvaro,L.P., Zazpe,J., Marchese,F.,
Torrea,N., Calvo,I.A., Lopez,C.K., Alignani,D., Lopez,A., Saez,B.,
Taylor-King,J.P., Prosper,F., Fortelny,N. and Huntly,B.J.P.
TITLE In vivo screening characterizes chromatin factor functions during
normal and malignant hematopoiesis
JOURNAL Nat Genet 55 (9), 1542-1554 (2023)
PUBMED 37580596
REFERENCE 6 (bases 1 to 1307)
AUTHORS Sowden,J.C., Morrison,K., Putt,W., Beddington,R. and Edwards,Y.H.
TITLE The identification of novel sequences expressed in the mouse
notochord
JOURNAL Mamm Genome 8 (1), 42-44 (1997)
PUBMED 9021147
REFERENCE 7 (bases 1 to 1307)
AUTHORS Inouye,C.J. and Seto,E.
TITLE Relief of YY1-induced transcriptional repression by protein-protein
interaction with the nucleolar phosphoprotein B23
JOURNAL J Biol Chem 269 (9), 6506-6510 (1994)
PUBMED 8120001
REFERENCE 8 (bases 1 to 1307)
AUTHORS Van den Eynde,B., Lethe,B., Van Pel,A., De Plaen,E. and Boon,T.
TITLE The gene coding for a major tumor rejection antigen of tumor P815
is identical to the normal gene of syngeneic DBA/2 mice
JOURNAL J Exp Med 173 (6), 1373-1384 (1991)
PUBMED 1903428
REFERENCE 9 (bases 1 to 1307)
AUTHORS Biggiogera,M., Burki,K., Kaufmann,S.H., Shaper,J.H., Gas,N.,
Amalric,F. and Fakan,S.
TITLE Nucleolar distribution of proteins B23 and nucleolin in mouse
preimplantation embryos as visualized by immunoelectron microscopy
JOURNAL Development 110 (4), 1263-1270 (1990)
PUBMED 2100262
REFERENCE 10 (bases 1 to 1307)
AUTHORS Schmidt-Zachmann,M.S. and Franke,W.W.
TITLE DNA cloning and amino acid sequence determination of a major
constituent protein of mammalian nucleoli. Correspondence of the
nucleoplasmin-related protein NO38 to mammalian protein B23
JOURNAL Chromosoma 96 (6), 417-426 (1988)
PUBMED 3219912
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
CA540276.1 and BC090843.1.
Transcript Variant: This variant (3) lacks two exons but has an
alternate 3' terminal exon, compared to variant 1. The resulting
isoform (3) is shorter and has a distinct C-terminus, compared to
isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC090843.1, AK005420.1 [ECO:0000332]
RNAseq introns :: mixed sample support SAMN00849374,
SAMN00849375 [ECO:0006172]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-249 CA540276.1 1-249
250-1307 BC090843.1 103-1160
FEATURES Location/Qualifiers
source 1..1307
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="11"
/map="11 19.21 cM"
gene 1..1307
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="nucleophosmin 1"
/db_xref="GeneID:18148"
/db_xref="MGI:MGI:106184"
exon 1..285
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
CDS 228..1001
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="isoform 3 is encoded by transcript variant 3;
numatrin; nucleolar phosphoprotein B23; nucleolar protein
NO38"
/codon_start=1
/product="nucleophosmin isoform 3"
/protein_id="NP_001239190.1"
/db_xref="CCDS:CCDS56765.1"
/db_xref="GeneID:18148"
/db_xref="MGI:MGI:106184"
/translation="
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKAH"
misc_feature 228..782
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="propagated from UniProtKB/Swiss-Prot (Q61937.1);
Region: Required for interaction with SENP3.
/evidence=ECO:0000250"
misc_feature 228..578
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="propagated from UniProtKB/Swiss-Prot (Q61937.1);
Region: Necessary for interaction with APEX1.
/evidence=ECO:0000250"
misc_feature 228..230
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N-acetylmethionine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 237..239
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine, by PLK1 and PLK2.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 255..257
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 279..578
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Nucleoplasmin/nucleophosmin domain; Region:
Nucleoplasmin; pfam03066"
/db_xref="CDD:460792"
misc_feature 321..323
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 354..356
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 390..392
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Interaction between pentamers.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (Q61937.1); other site"
misc_feature 426..428
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphotyrosine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 435..437
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:19144319,
ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 450..452
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphothreonine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 465..467
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Interaction between pentamers.
/evidence=ECO:0000250; propagated from
UniProtKB/Swiss-Prot (Q61937.1); other site"
misc_feature 510..512
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphothreonine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 600..602
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:16452087,
ECO:0007744|PubMed:17242355, ECO:0007744|PubMed:18630941,
ECO:0007744|PubMed:19131326, ECO:0007744|PubMed:19144319,
ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 639..971
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="propagated from UniProtKB/Swiss-Prot (Q61937.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 642..644
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 675..677
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 681..698
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="propagated from UniProtKB/Swiss-Prot (Q61937.1);
Region: Nuclear localization signal.
/evidence=ECO:0000255"
misc_feature 687..689
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 783..869
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="propagated from UniProtKB/Swiss-Prot (Q61937.1);
Region: Interaction with NOP2.
/evidence=ECO:0000250|UniProtKB:P06748"
misc_feature 795..815
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="propagated from UniProtKB/Swiss-Prot (Q61937.1);
Region: Nuclear localization signal.
/evidence=ECO:0000255"
misc_feature 819..821
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphothreonine, by CDK1 and CDK2.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 858..860
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 876..878
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphothreonine, by CDK1. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q61937.1);
phosphorylation site"
misc_feature 900..902
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 906..908
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 909..911
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 921..923
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphothreonine, by CDK1.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 930..932
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphothreonine, by CDK1.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 945..947
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 948..950
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 969..971
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
misc_feature 981..983
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P06748; propagated from
UniProtKB/Swiss-Prot (Q61937.1); phosphorylation site"
misc_feature 990..992
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0007744|PubMed:23806337; propagated from
UniProtKB/Swiss-Prot (Q61937.1); acetylation site"
exon 286..365
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 366..485
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 486..579
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 580..686
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 687..748
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 749..806
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 807..890
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 891..992
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
exon 993..1288
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/inference="alignment:Splign:2.1.0"
regulatory 1267..1272
/regulatory_class="polyA_signal_sequence"
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="hexamer: AATAAA"
polyA_site 1288
/gene="Npm1"
/gene_synonym="B23; NO38; Npm"
/note="major polyA site"
ORIGIN
ggcgcacgcgcaaaagcgcgactgtgcggggagtgggagggatccagaggaggctcgcggaggcaggactagcgcagatctcgcgagatctcctgcgaccatatatacgtgcggagagcccgcgtcctttccttggcgtgattccgtcctgcgcgtctgttctgtggaacaggaggcagttgttttccgtccggcttctcccacaccgaagtgcgcgcctccacctcatggaagactcgatggatatggacatgagtcctcttaggcctcagaactaccttttcggctgtgaactaaaggctgacaaagactatcactttaaagtggataatgatgaaaatgagcaccagttgtcattaagaacggtcagtttaggagcaggggcaaaagatgagttacacatcgtagaggcagaagcaatgaactatgaaggcagtccaattaaagtaacactggcaactttgaaaatgtctgtacaaccaacagtttccctagggggctttgaaattacaccacctgtggtcttacggttgaagtgtggttcagggcctgtgcacattagtggacagcatctagtagctgtagaggaagatgcagagtctgaagatgaagatgaggaggacgtaaaactcttaggcatgtctggaaagcgatctgctcctggaggtggtaacaaggttccacagaaaaaagtaaaacttgatgaagatgatgaggacgatgatgaggacgatgaggatgatgaggatgatgatgatgatgattttgatgaagaggaaactgaagaaaaggtcccagtgaagaaatctgtacgagataccccagccaaaaatgcacaaaaatcaaaccaaaatggaaaagacttaaaaccatcaacaccgagatcaaagggtcaagagtccttcaaaaaacaggaaaagactcctaaaacaccaaaaggacctagttctgtagaagacattaaggcaaaaatgcaagcaagtatagaaaaagcgcattgaacattcctgggcactactggtaaattaagcccaaagatggggaaagaggaaaaggagaaacaaatatagtaccatcaacaatccagacatctcaatcccctttcctgattggccatccattcccccttgcaggctggaagcaatcttgtttttcctaaagcatttttcttttacttttgtgatgcagaaaactacttctctaccacttgtgcatatgcctcatttctttgaccatgttttaacctttgtatccttagctactctcaataaatttttaaatgaatcaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]