2025-01-31 11:32:01, GGRNA.v2 : RefSeq release 227 (Nov, 2024)
LOCUS NM_001194922 2849 bp mRNA linear ROD 26-JUN-2024 DEFINITION Mus musculus claudin 18 (Cldn18), transcript variant A1.2, mRNA. ACCESSION NM_001194922 VERSION NM_001194922.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2849) AUTHORS De Sanctis,F., Dusi,S., Caligola,S., Anselmi,C., Petrova,V., Rossi,B., Angelini,G., Erdeljan,M., Woll,S., Schlitter,A.M., Metzler,T., Steiger,K., Borok,Z., Bailey,P., Bauer,A., Halin,C., Boschi,F., Giugno,R., Cane,S., Lawlor,R., Corbo,V., Scarpa,A., Constantin,G., Ugel,S., Vascotto,F., Sahin,U., Tureci,O. and Bronte,V. TITLE Expression of the membrane tetraspanin claudin 18 on cancer cells promotes T lymphocyte infiltration and antitumor immunity in pancreatic cancer JOURNAL Immunity 57 (6), 1378-1393 (2024) PUBMED 38749447 REMARK GeneRIF: Expression of the membrane tetraspanin claudin 18 on cancer cells promotes T lymphocyte infiltration and antitumor immunity in pancreatic cancer. REFERENCE 2 (bases 1 to 2849) AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A., Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R., Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J., Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z., Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J., Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L., Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J., Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B., Jackson,S.P. and Balmus,G. CONSRTM Sanger Mouse Genetics Project TITLE Genetic determinants of micronucleus formation in vivo JOURNAL Nature 627 (8002), 130-136 (2024) PUBMED 38355793 REFERENCE 3 (bases 1 to 2849) AUTHORS Liu,Y., Sun,Y., Wang,P., Li,S., Dong,Y., Zhou,M., Shi,B., Jiang,H., Sun,R. and Li,Z. TITLE FAP-targeted CAR-T suppresses MDSCs recruitment to improve the antitumor efficacy of claudin18.2-targeted CAR-T against pancreatic cancer JOURNAL J Transl Med 21 (1), 255 (2023) PUBMED 37046312 REMARK GeneRIF: FAP-targeted CAR-T suppresses MDSCs recruitment to improve the antitumor efficacy of claudin18.2-targeted CAR-T against pancreatic cancer. Publication Status: Online-Only REFERENCE 4 (bases 1 to 2849) AUTHORS Fatehullah,A., Terakado,Y., Sagiraju,S., Tan,T.L., Sheng,T., Tan,S.H., Murakami,K., Swathi,Y., Ang,N., Rajarethinam,R., Ming,T., Tan,P., Lee,B. and Barker,N. TITLE A tumour-resident Lgr5+ stem-cell-like pool drives the establishment and progression of advanced gastric cancers JOURNAL Nat Cell Biol 23 (12), 1299-1313 (2021) PUBMED 34857912 REFERENCE 5 (bases 1 to 2849) AUTHORS Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and Chiba,H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 2849) AUTHORS Arabzadeh,A., Troy,T.C. and Turksen,K. TITLE Changes in the distribution pattern of Claudin tight junction proteins during the progression of mouse skin tumorigenesis JOURNAL BMC Cancer 7, 196 (2007) PUBMED 17945025 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 2849) AUTHORS Troy,T.C., Li,Y., O'Malley,L. and Turksen,K. TITLE The temporal and spatial expression of Claudins in epidermal development and the accelerated program of epidermal differentiation in K14-CaSR transgenic mice JOURNAL Gene Expr Patterns 7 (4), 423-430 (2007) PUBMED 17182288 REFERENCE 8 (bases 1 to 2849) AUTHORS Hatakeyama,J., Bessho,Y., Katoh,K., Ookawara,S., Fujioka,M., Guillemot,F. and Kageyama,R. TITLE Hes genes regulate size, shape and histogenesis of the nervous system by control of the timing of neural stem cell differentiation JOURNAL Development 131 (22), 5539-5550 (2004) PUBMED 15496443 REFERENCE 9 (bases 1 to 2849) AUTHORS Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H., Ito,J. and Tsukita,S. TITLE Expression patterns of claudins, tight junction adhesion molecules, in the inner ear JOURNAL Hear Res 187 (1-2), 25-34 (2004) PUBMED 14698084 REMARK GeneRIF: Claudin-18 is expressed at the variety of epithelial tissues in inner ear including Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, and dark cell area. REFERENCE 10 (bases 1 to 2849) AUTHORS Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B., Popescu,N.C. and Kimura,S. TITLE claudin-18, a novel downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor, encodes lung- and stomach-specific isoforms through alternative splicing JOURNAL Mol Cell Biol 21 (21), 7380-7390 (2001) PUBMED 11585919 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BB663682.1, AK033657.1, AF349450.1 and AC157949.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is a downstream target gene regulated by the T/EBP/NKX2.1 homeodomain transcription factor. Four alternatively spliced transcript variants resulted from alternative promoters and alternative splicing have been identified, which encode two lung-specific isoforms and two stomach-specific isoforms respectively. This gene is also expressed in colons, inner ear and skin, and its expression is increased in both experimental colitis and ulcerative colitis. [provided by RefSeq, Aug 2010]. Transcript Variant: This variant (A1.2) is the lung-specific form. It has an additional segment in the CDS, which results in an immediate translation termination, as compared to variant A1.1. The resulting isoform (A1.2) is C-terminal truncated, as compared to isoform A1.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF349450.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849387 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-612 BB663682.1 1-612 613-738 AK033657.1 551-676 739-1463 AF349450.1 685-1409 1464-2849 AC157949.1 94702-96087 FEATURES Location/Qualifiers source 1..2849 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="9" /map="9 52.0 cM" gene 1..2849 /gene="Cldn18" /note="claudin 18" /db_xref="GeneID:56492" /db_xref="MGI:MGI:1929209" exon 1..335 /gene="Cldn18" /inference="alignment:Splign:2.1.0" misc_feature 23..25 /gene="Cldn18" /note="upstream in-frame stop codon" CDS 116..742 /gene="Cldn18" /note="isoform A1.2 precursor is encoded by transcript variant A1.2; Claudin-18" /codon_start=1 /product="claudin-18 isoform A1.2 precursor" /protein_id="NP_001181851.1" /db_xref="CCDS:CCDS57692.1" /db_xref="GeneID:56492" /db_xref="MGI:MGI:1929209" /translation="
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSK"
sig_peptide 116..187 /gene="Cldn18" /inference="COORDINATES: ab initio prediction:SignalP:6.0" misc_feature 134..196 /gene="Cldn18" /note="propagated from UniProtKB/Swiss-Prot (P56857.1); transmembrane region" misc_feature <242..697 /gene="Cldn18" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 356..418 /gene="Cldn18" /note="propagated from UniProtKB/Swiss-Prot (P56857.1); transmembrane region" misc_feature 482..544 /gene="Cldn18" /note="propagated from UniProtKB/Swiss-Prot (P56857.1); transmembrane region" misc_feature 644..706 /gene="Cldn18" /note="propagated from UniProtKB/Swiss-Prot (P56857.1); transmembrane region" exon 336..500 /gene="Cldn18" /inference="alignment:Splign:2.1.0" exon 501..627 /gene="Cldn18" /inference="alignment:Splign:2.1.0" exon 628..750 /gene="Cldn18" /inference="alignment:Splign:2.1.0" exon 751..2849 /gene="Cldn18" /inference="alignment:Splign:2.1.0" regulatory 2822..2827 /regulatory_class="polyA_signal_sequence" /gene="Cldn18" /note="hexamer: ATTAAA" polyA_site 2849 /gene="Cldn18" /note="major polyA site" ORIGIN
tgagctgaggggagcttctgattaagagcgctccccagcgaggcccgaggccgtgaaccttcccagcaagagggtggtggttgctcctggaagcctgcgcccagcagctgaagccatggccaccaccacgtgccaggtggtagggcttctcctgtccctcctgggtctggccggctgcatagccgccactgggatggacatgtggagcactcaagacctgtatgacaacccagtcaccgccgtgttccagtatgaagggctctggaggagttgcgtgcaacagagctcggggttcaccgagtgccggccatacttcaccatcctgggccttccagccatgctgcaagctgtacgagccctgatgatcgtgggcattgttctgggggtcatcggtatcctcgtgtccatcttcgccctgaagtgcattcgcattggtagcatggatgactctgccaaggccaagatgactctgacttctgggatcttgttcatcatctccggcatctgtgcaatcattggtgtgtctgtgtttgccaacatgctggtgaccaacttctggatgtccacagctaacatgtacagcggcatgggcggcatgggtggcatggtgcagaccgttcagaccaggtacacctttggtgcagctctgttcgtgggctgggttgctggaggcctcaccctgattgggggagtgatgatgtgcatcgcctgccgtggcctgacaccagatgacagcaagtgagtcctccccttcaaagctgtgtcttaccatgcctctggccaaaatgttgcctacaggcctggaggctttaaggccagcactggctttgggtccaacaccagaaacaagaagatctacgatgggggtgcccgcacagaagacgatgaacagtctcatcctaccaagtatgactatgtgtagtgctctaagacccgccaacctgtgtgcaggaggaacccttccccaagaagagctcaccccaaagcaacgggagtctaccttgttcccttgttgatttcaactgacatctgaaagttggtaaagcctgattttcatccatagggaggctagacagtcttggccacatgtgtctgcctctaaatatcccatcacaaaacagctgagttatcgtttatgagttagaggccataacactcactttagcccaaccctctgctttttaccgtagactttcttttcatctggtgatggaatggaatttgactcacagactaatactttaatggtttagagaaactttccttcctcgtacttaataagcctgctgatggtcgattttccagcttgaccaccaagggaaattttaaaaggaaaaaaaaatacattaaaaggcattatttcctactcaattgtgccttacccacccccaacttgactgataataataatgaacaccacttaaagaaagaatgccagaggaaagatagttgtgtttccccccagccagtcatctgagtccccctatgtggtgatctagaacattactcgccacagtgattttcaaagaaggcaagcgagcctgttcgctctgctcagcatctgctgattccagcaaggcccttccagagctttccactagaagtcctccttctctcggaagtcagaaattccccctagaagagtaagaaatagattcttttgggtaacctgagtcctaggtatagttataataaatagtatattagcaaaacggtttggtatctcagtgaattagtttcagccttacatatagaaaaagctggggaaaaaaaagcatcccttgacattgtctatagcgtaagatcctatataaatccaagcttcaacaaaagctcactgagtctaatagttttcttttgaggtctccacggccttagtactcatagatgcagcccctgtttaaaagtaaaaaaattaaagtagcttaaaacgggttctttttttttttttttttttcaaaaaatccaatagagacctgtgtgtctggcatagctacagttactgccaatcgacagggccacttctttggtcctgtaggcagttttgcagttctgacagctgcgccgggcatcaatatgcagaccacacccttctctgtgcttgtaggacgacccgttcaaggagaaagcatgaactccatctccatgtgagcctgaatgctcccaggaaatggagatagggtgctctctaaaacccacctgaacctgaaacagctgtagcgctatgctgtaagagcctggccatcaagttcctatggagaaaaagggcagtccttgcattaatagtgcatatataagtggcctctggggggcagggatgaatattcagtggtggctccgagtatgtacagaccgtctaaggagctgtgttgaccaagagccaggttaatacgcagagtttttcccactgggactacagtgattttagactatactgaagaaggccctctggaaaatcattatctgaaatggcataaagaatgaacagaccaaacaatttaaggggagggggcaggtggaaggagggggaaggaggtagaaataagcaatctagggcatgaagattgttaaggttcttggggtccaaatggaaggtcacccctttgaggccatggacacaatgcaccccacccctacccccacctgcccacccaccagaaagtccctggtcggactggaggcagtgagaatcagctgttttcagttagtgggtctcggtgtagcacctggctgtttcaaagcttccccttgctttgccgttttttccgccattgctgtcttgttttctgtgttattaacctccatgttttgtacgttaaatattaaaacactgttaacatccattcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]