GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-01-31 11:32:01, GGRNA.v2 : RefSeq release 227 (Nov, 2024)

LOCUS       NM_001194922            2849 bp    mRNA    linear   ROD 26-JUN-2024
DEFINITION  Mus musculus claudin 18 (Cldn18), transcript variant A1.2, mRNA.
ACCESSION   NM_001194922
VERSION     NM_001194922.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2849)
  AUTHORS   De Sanctis,F., Dusi,S., Caligola,S., Anselmi,C., Petrova,V.,
            Rossi,B., Angelini,G., Erdeljan,M., Woll,S., Schlitter,A.M.,
            Metzler,T., Steiger,K., Borok,Z., Bailey,P., Bauer,A., Halin,C.,
            Boschi,F., Giugno,R., Cane,S., Lawlor,R., Corbo,V., Scarpa,A.,
            Constantin,G., Ugel,S., Vascotto,F., Sahin,U., Tureci,O. and
            Bronte,V.
  TITLE     Expression of the membrane tetraspanin claudin 18 on cancer cells
            promotes T lymphocyte infiltration and antitumor immunity in
            pancreatic cancer
  JOURNAL   Immunity 57 (6), 1378-1393 (2024)
   PUBMED   38749447
  REMARK    GeneRIF: Expression of the membrane tetraspanin claudin 18 on
            cancer cells promotes T lymphocyte infiltration and antitumor
            immunity in pancreatic cancer.
REFERENCE   2  (bases 1 to 2849)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   3  (bases 1 to 2849)
  AUTHORS   Liu,Y., Sun,Y., Wang,P., Li,S., Dong,Y., Zhou,M., Shi,B., Jiang,H.,
            Sun,R. and Li,Z.
  TITLE     FAP-targeted CAR-T suppresses MDSCs recruitment to improve the
            antitumor efficacy of claudin18.2-targeted CAR-T against pancreatic
            cancer
  JOURNAL   J Transl Med 21 (1), 255 (2023)
   PUBMED   37046312
  REMARK    GeneRIF: FAP-targeted CAR-T suppresses MDSCs recruitment to improve
            the antitumor efficacy of claudin18.2-targeted CAR-T against
            pancreatic cancer.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2849)
  AUTHORS   Fatehullah,A., Terakado,Y., Sagiraju,S., Tan,T.L., Sheng,T.,
            Tan,S.H., Murakami,K., Swathi,Y., Ang,N., Rajarethinam,R., Ming,T.,
            Tan,P., Lee,B. and Barker,N.
  TITLE     A tumour-resident Lgr5+ stem-cell-like pool drives the
            establishment and progression of advanced gastric cancers
  JOURNAL   Nat Cell Biol 23 (12), 1299-1313 (2021)
   PUBMED   34857912
REFERENCE   5  (bases 1 to 2849)
  AUTHORS   Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and
            Chiba,H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2849)
  AUTHORS   Arabzadeh,A., Troy,T.C. and Turksen,K.
  TITLE     Changes in the distribution pattern of Claudin tight junction
            proteins during the progression of mouse skin tumorigenesis
  JOURNAL   BMC Cancer 7, 196 (2007)
   PUBMED   17945025
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 2849)
  AUTHORS   Troy,T.C., Li,Y., O'Malley,L. and Turksen,K.
  TITLE     The temporal and spatial expression of Claudins in epidermal
            development and the accelerated program of epidermal
            differentiation in K14-CaSR transgenic mice
  JOURNAL   Gene Expr Patterns 7 (4), 423-430 (2007)
   PUBMED   17182288
REFERENCE   8  (bases 1 to 2849)
  AUTHORS   Hatakeyama,J., Bessho,Y., Katoh,K., Ookawara,S., Fujioka,M.,
            Guillemot,F. and Kageyama,R.
  TITLE     Hes genes regulate size, shape and histogenesis of the nervous
            system by control of the timing of neural stem cell differentiation
  JOURNAL   Development 131 (22), 5539-5550 (2004)
   PUBMED   15496443
REFERENCE   9  (bases 1 to 2849)
  AUTHORS   Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H.,
            Ito,J. and Tsukita,S.
  TITLE     Expression patterns of claudins, tight junction adhesion molecules,
            in the inner ear
  JOURNAL   Hear Res 187 (1-2), 25-34 (2004)
   PUBMED   14698084
  REMARK    GeneRIF: Claudin-18 is expressed at the variety of epithelial
            tissues in inner ear including Organ of Corti, stria vascularis,
            Reissner's membrane, spiral limbus, vestibular sensory epithelia,
            and dark cell area.
REFERENCE   10 (bases 1 to 2849)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BB663682.1, AK033657.1,
            AF349450.1 and AC157949.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. This gene is a downstream target gene
            regulated by the T/EBP/NKX2.1 homeodomain transcription factor.
            Four alternatively spliced transcript variants resulted from
            alternative promoters and alternative splicing have been
            identified, which encode two lung-specific isoforms and two
            stomach-specific isoforms respectively. This gene is also expressed
            in colons, inner ear and skin, and its expression is increased in
            both experimental colitis and ulcerative colitis. [provided by
            RefSeq, Aug 2010].
            
            Transcript Variant: This variant (A1.2) is the lung-specific form.
            It has an additional segment in the CDS, which results in an
            immediate translation termination, as compared to variant A1.1. The
            resulting isoform (A1.2) is C-terminal truncated, as compared to
            isoform A1.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF349450.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849387 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-612               BB663682.1         1-612
            613-738             AK033657.1         551-676
            739-1463            AF349450.1         685-1409
            1464-2849           AC157949.1         94702-96087
FEATURES             Location/Qualifiers
     source          1..2849
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="9"
                     /map="9 52.0 cM"
     gene            1..2849
                     /gene="Cldn18"
                     /note="claudin 18"
                     /db_xref="GeneID:56492"
                     /db_xref="MGI:MGI:1929209"
     exon            1..335
                     /gene="Cldn18"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    23..25
                     /gene="Cldn18"
                     /note="upstream in-frame stop codon"
     CDS             116..742
                     /gene="Cldn18"
                     /note="isoform A1.2 precursor is encoded by transcript
                     variant A1.2; Claudin-18"
                     /codon_start=1
                     /product="claudin-18 isoform A1.2 precursor"
                     /protein_id="NP_001181851.1"
                     /db_xref="CCDS:CCDS57692.1"
                     /db_xref="GeneID:56492"
                     /db_xref="MGI:MGI:1929209"
                     /translation="
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLTSGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLTPDDSK"
     sig_peptide     116..187
                     /gene="Cldn18"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    134..196
                     /gene="Cldn18"
                     /note="propagated from UniProtKB/Swiss-Prot (P56857.1);
                     transmembrane region"
     misc_feature    <242..697
                     /gene="Cldn18"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    356..418
                     /gene="Cldn18"
                     /note="propagated from UniProtKB/Swiss-Prot (P56857.1);
                     transmembrane region"
     misc_feature    482..544
                     /gene="Cldn18"
                     /note="propagated from UniProtKB/Swiss-Prot (P56857.1);
                     transmembrane region"
     misc_feature    644..706
                     /gene="Cldn18"
                     /note="propagated from UniProtKB/Swiss-Prot (P56857.1);
                     transmembrane region"
     exon            336..500
                     /gene="Cldn18"
                     /inference="alignment:Splign:2.1.0"
     exon            501..627
                     /gene="Cldn18"
                     /inference="alignment:Splign:2.1.0"
     exon            628..750
                     /gene="Cldn18"
                     /inference="alignment:Splign:2.1.0"
     exon            751..2849
                     /gene="Cldn18"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2822..2827
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn18"
                     /note="hexamer: ATTAAA"
     polyA_site      2849
                     /gene="Cldn18"
                     /note="major polyA site"
ORIGIN      
tgagctgaggggagcttctgattaagagcgctccccagcgaggcccgaggccgtgaaccttcccagcaagagggtggtggttgctcctggaagcctgcgcccagcagctgaagccatggccaccaccacgtgccaggtggtagggcttctcctgtccctcctgggtctggccggctgcatagccgccactgggatggacatgtggagcactcaagacctgtatgacaacccagtcaccgccgtgttccagtatgaagggctctggaggagttgcgtgcaacagagctcggggttcaccgagtgccggccatacttcaccatcctgggccttccagccatgctgcaagctgtacgagccctgatgatcgtgggcattgttctgggggtcatcggtatcctcgtgtccatcttcgccctgaagtgcattcgcattggtagcatggatgactctgccaaggccaagatgactctgacttctgggatcttgttcatcatctccggcatctgtgcaatcattggtgtgtctgtgtttgccaacatgctggtgaccaacttctggatgtccacagctaacatgtacagcggcatgggcggcatgggtggcatggtgcagaccgttcagaccaggtacacctttggtgcagctctgttcgtgggctgggttgctggaggcctcaccctgattgggggagtgatgatgtgcatcgcctgccgtggcctgacaccagatgacagcaagtgagtcctccccttcaaagctgtgtcttaccatgcctctggccaaaatgttgcctacaggcctggaggctttaaggccagcactggctttgggtccaacaccagaaacaagaagatctacgatgggggtgcccgcacagaagacgatgaacagtctcatcctaccaagtatgactatgtgtagtgctctaagacccgccaacctgtgtgcaggaggaacccttccccaagaagagctcaccccaaagcaacgggagtctaccttgttcccttgttgatttcaactgacatctgaaagttggtaaagcctgattttcatccatagggaggctagacagtcttggccacatgtgtctgcctctaaatatcccatcacaaaacagctgagttatcgtttatgagttagaggccataacactcactttagcccaaccctctgctttttaccgtagactttcttttcatctggtgatggaatggaatttgactcacagactaatactttaatggtttagagaaactttccttcctcgtacttaataagcctgctgatggtcgattttccagcttgaccaccaagggaaattttaaaaggaaaaaaaaatacattaaaaggcattatttcctactcaattgtgccttacccacccccaacttgactgataataataatgaacaccacttaaagaaagaatgccagaggaaagatagttgtgtttccccccagccagtcatctgagtccccctatgtggtgatctagaacattactcgccacagtgattttcaaagaaggcaagcgagcctgttcgctctgctcagcatctgctgattccagcaaggcccttccagagctttccactagaagtcctccttctctcggaagtcagaaattccccctagaagagtaagaaatagattcttttgggtaacctgagtcctaggtatagttataataaatagtatattagcaaaacggtttggtatctcagtgaattagtttcagccttacatatagaaaaagctggggaaaaaaaagcatcccttgacattgtctatagcgtaagatcctatataaatccaagcttcaacaaaagctcactgagtctaatagttttcttttgaggtctccacggccttagtactcatagatgcagcccctgtttaaaagtaaaaaaattaaagtagcttaaaacgggttctttttttttttttttttttcaaaaaatccaatagagacctgtgtgtctggcatagctacagttactgccaatcgacagggccacttctttggtcctgtaggcagttttgcagttctgacagctgcgccgggcatcaatatgcagaccacacccttctctgtgcttgtaggacgacccgttcaaggagaaagcatgaactccatctccatgtgagcctgaatgctcccaggaaatggagatagggtgctctctaaaacccacctgaacctgaaacagctgtagcgctatgctgtaagagcctggccatcaagttcctatggagaaaaagggcagtccttgcattaatagtgcatatataagtggcctctggggggcagggatgaatattcagtggtggctccgagtatgtacagaccgtctaaggagctgtgttgaccaagagccaggttaatacgcagagtttttcccactgggactacagtgattttagactatactgaagaaggccctctggaaaatcattatctgaaatggcataaagaatgaacagaccaaacaatttaaggggagggggcaggtggaaggagggggaaggaggtagaaataagcaatctagggcatgaagattgttaaggttcttggggtccaaatggaaggtcacccctttgaggccatggacacaatgcaccccacccctacccccacctgcccacccaccagaaagtccctggtcggactggaggcagtgagaatcagctgttttcagttagtgggtctcggtgtagcacctggctgtttcaaagcttccccttgctttgccgttttttccgccattgctgtcttgttttctgtgttattaacctccatgttttgtacgttaaatattaaaacactgttaacatccattcaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]