LOCUS       NM_001164075            1720 bp    mRNA    linear   ROD 01-JUL-2024
DEFINITION  Mus musculus TGFB-induced factor homeobox 1 (Tgif1), transcript
            variant 1, mRNA.
ACCESSION   NM_001164075
VERSION     NM_001164075.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1720)
  AUTHORS   Chang,Y.H., Tseng,Y.H., Wang,J.M., Tsai,Y.S. and Huang,H.S.
  TITLE     TG-interacting factor 1 regulates mitotic clonal expansion during
            adipocyte differentiation
  JOURNAL   Biochim Biophys Acta Mol Cell Biol Lipids 1869 (5), 159492 (2024)
   PUBMED   38575107
  REMARK    GeneRIF: TG-interacting factor 1 regulates mitotic clonal expansion
            during adipocyte differentiation.
REFERENCE   2  (bases 1 to 1720)
  AUTHORS   Cong,M., Li,J., Wang,L., Liu,C., Zheng,M., Zhou,Q., Du,M., Ye,X.,
            Feng,M., Ye,Y., Zhang,S., Xu,W., Lu,Y., Wang,C., Xia,Y., Xie,H.,
            Zhang,Y., He,Q., Gong,L., Gu,Y., Sun,H., Zhang,Q., Zhao,J.,
            Ding,F., Gu,X. and Zhou,S.
  TITLE     MircoRNA-25-3p in skin precursor cell-induced Schwann cell-derived
            extracellular vesicles promotes axon regeneration by targeting
            Tgif1
  JOURNAL   Exp Neurol 376, 114750 (2024)
   PUBMED   38492636
  REMARK    GeneRIF: MircoRNA-25-3p in skin precursor cell-induced Schwann
            cell-derived extracellular vesicles promotes axon regeneration by
            targeting Tgif1.
REFERENCE   3  (bases 1 to 1720)
  AUTHORS   Bolamperti,S., Saito,H., Heerdmann,S., Hesse,E. and
            Taipaleenmaki,H.
  TITLE     Tgif1-deficiency impairs cytoskeletal architecture in osteoblasts
            by activating PAK3 signaling
  JOURNAL   Elife 13, 94265 (2024)
   PUBMED   38661167
  REMARK    GeneRIF: Tgif1-deficiency impairs cytoskeletal architecture in
            osteoblasts by activating PAK3 signaling.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1720)
  AUTHORS   Taipaleenmaki,H., Saito,H., Schroder,S., Maeda,M., Mettler,R.,
            Ring,M., Rollmann,E., Gasser,A., Haasper,C., Gehrke,T., Weiss,A.,
            Grimm,S.K. and Hesse,E.
  TITLE     Antagonizing microRNA-19a/b augments PTH anabolic action and
            restores bone mass in osteoporosis in mice
  JOURNAL   EMBO Mol Med 14 (11), e13617 (2022)
   PUBMED   36193848
REFERENCE   5  (bases 1 to 1720)
  AUTHORS   Astanina,E., Doronzo,G., Cora,D., Neri,F., Oliviero,S., Genova,T.,
            Mussano,F., Middonti,E., Vallariello,E., Cencioni,C., Valdembri,D.,
            Serini,G., Limana,F., Foglio,E., Ballabio,A. and Bussolino,F.
  TITLE     The TFEB-TGIF1 axis regulates EMT in mouse epicardial cells
  JOURNAL   Nat Commun 13 (1), 5191 (2022)
   PUBMED   36057632
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1720)
  AUTHORS   Zhang,X., Friedman,A., Heaney,S., Purcell,P. and Maas,R.L.
  TITLE     Meis homeoproteins directly regulate Pax6 during vertebrate lens
            morphogenesis
  JOURNAL   Genes Dev 16 (16), 2097-2107 (2002)
   PUBMED   12183364
REFERENCE   7  (bases 1 to 1720)
  AUTHORS   Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S.
  TITLE     Construction of long-transcript enriched cDNA libraries from
            submicrogram amounts of total RNAs by a universal PCR amplification
            method
  JOURNAL   Genome Res 11 (9), 1553-1558 (2001)
   PUBMED   11544199
REFERENCE   8  (bases 1 to 1720)
  AUTHORS   Melhuish,T.A. and Wotton,D.
  TITLE     The interaction of the carboxyl terminus-binding protein with the
            Smad corepressor TGIF is disrupted by a holoprosencephaly mutation
            in TGIF
  JOURNAL   J Biol Chem 275 (50), 39762-39766 (2000)
   PUBMED   10995736
REFERENCE   9  (bases 1 to 1720)
  AUTHORS   Lee,C.K., Klopp,R.G., Weindruch,R. and Prolla,T.A.
  TITLE     Gene expression profile of aging and its retardation by caloric
            restriction
  JOURNAL   Science 285 (5432), 1390-1393 (1999)
   PUBMED   10464095
REFERENCE   10 (bases 1 to 1720)
  AUTHORS   Bertolino,E., Wildt,S., Richards,G. and Clerc,R.G.
  TITLE     Expression of a novel murine homeobox gene in the developing
            cerebellar external granular layer during its proliferation
  JOURNAL   Dev Dyn 205 (4), 410-420 (1996)
   PUBMED   8901052
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CT009715.15 and AC079441.37.
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes the longest isoform (a).
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC012700.1, SRR1660813.108926.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN01164133
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-425               CT009715.15        103350-103774       c
            426-652             AC079441.37        218108-218334       c
            653-1720            AC079441.37        216141-217208       c
FEATURES             Location/Qualifiers
     source          1..1720
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 41.87 cM"
     gene            1..1720
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="TGFB-induced factor homeobox 1"
                     /db_xref="GeneID:21815"
                     /db_xref="MGI:MGI:1194497"
     exon            1..425
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    305..307
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="upstream in-frame stop codon"
     CDS             311..1228
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="isoform a is encoded by transcript variant 1;
                     homeobox protein TGIF1; 5'-TG-3'-interacting factor 1;
                     TALE family homeobox; TG interacting factor 1"
                     /codon_start=1
                     /product="homeobox protein TGIF1 isoform a"
                     /protein_id="NP_001157547.1"
                     /db_xref="CCDS:CCDS50175.1"
                     /db_xref="GeneID:21815"
                     /db_xref="MGI:MGI:1194497"
                     /translation="

MEMVLSPRAGRHDPASGFRQRVEGRVISAPRPRVVELEGLVAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA"

     misc_feature    order(515..529,533..535,593..595,611..613,650..652,
                     656..661,668..673,677..685)
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(521..523,530..532,659..661,668..673,680..682)
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    569..685
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     exon            426..652
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /inference="alignment:Splign:2.1.0"
     exon            653..1720
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1690..1695
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="hexamer: AATAAA"
     polyA_site      1714
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="major polyA site"
ORIGIN      

gcgctgtgccgcgcccgcgtgtcaatggcagctgcgccttctggaagaagttgattcttgtctggaatacttttccttcggtgccccaccccttgaatcagaagctgctgcctccggcggctggagcagagacagtgaagtttggggcagctgtcaaaaacaaggatgggggtgtcttttcttctctggggtggacagaggagatgtccttaaacctctctccatcctttacaaactaaatgcactcttcgctagcccggggaggaaaggccccaaaagagaaaccagtgtggccgctgagagctgagggatggagatggtgctctcgccacgggcaggcaggcatgaccctgcttctgggttccgccagcgcgtagagggacgggtgatctcggcccccaggcccagggttgtggagctggaaggtcttgttgcagcatctggcagtgactctgaggatgaagacagcatggacagtcccctggacctttcctcatcagcagcctctggcaagagaaggaggagaggcaatctgcccaaggagtcagtccagattctgcgagactggctgtatgaacacagatacaacgcctatccctcagagcaagagaaagcactgctgtcccagcagacacacctgtccacactacaggtctgtaactggttcatcaacgcccgccgcaggctccttcctgacatgctgagaaaggatggcaaagatccaaatcagttcacgatttcccgccgtggggccaagatttcagaagctagctctattgaagctgcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgtagttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccaggatccattttggctcgcccgtcagtgatctgccataccactgtgactgcattgaaggatgggcctttctctctctgtcagccgattggtgtgggacagagtacagatgtaccgcaaatagcacccagcaactttacagacacctctctcgtgtacccagaggacacttgcaaatctggacccagtccaaaccctcagagtggtcttttcaacactcctccccctactccaccagacctcaaccaggattttagtggattccagcttctagtggatgttgcactcaaacgagcggcagagatggagcttcaggccaaactcacagcttaaccgttttttcaaacaaaacagttctccaaaatacggtcctgattgccgggggtgatggcaagagatgcattattttatatatttttctattaatatttgcacatgggattgctcagacgaagcttcctgttactaagatgtcttaagtggaatagagtcattccaagaactacaaactaaagctactgtagaaacaaagggttttcttttcgaatgtttcttggtagtttctcataatgtgagacggttcccagtatcatgtgatcttctcctccagactcctcttctttatgttccaagactgtgcaatactttagacgccctcgcacctctctcttcccatgtggaatgggacgcccacctacagtctaatgagtaaactttcagttttttgtttgtttgtttttttttagattcaagcaagtatgaatctagttgttggataccttttttcatgatgtaataaagtattttctttaaaagttattgcaa

//