2025-04-20 02:28:00, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001164074 1380 bp mRNA linear ROD 01-JUL-2024 DEFINITION Mus musculus TGFB-induced factor homeobox 1 (Tgif1), transcript variant 3, mRNA. ACCESSION NM_001164074 VERSION NM_001164074.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1380) AUTHORS Chang,Y.H., Tseng,Y.H., Wang,J.M., Tsai,Y.S. and Huang,H.S. TITLE TG-interacting factor 1 regulates mitotic clonal expansion during adipocyte differentiation JOURNAL Biochim Biophys Acta Mol Cell Biol Lipids 1869 (5), 159492 (2024) PUBMED 38575107 REMARK GeneRIF: TG-interacting factor 1 regulates mitotic clonal expansion during adipocyte differentiation. REFERENCE 2 (bases 1 to 1380) AUTHORS Cong,M., Li,J., Wang,L., Liu,C., Zheng,M., Zhou,Q., Du,M., Ye,X., Feng,M., Ye,Y., Zhang,S., Xu,W., Lu,Y., Wang,C., Xia,Y., Xie,H., Zhang,Y., He,Q., Gong,L., Gu,Y., Sun,H., Zhang,Q., Zhao,J., Ding,F., Gu,X. and Zhou,S. TITLE MircoRNA-25-3p in skin precursor cell-induced Schwann cell-derived extracellular vesicles promotes axon regeneration by targeting Tgif1 JOURNAL Exp Neurol 376, 114750 (2024) PUBMED 38492636 REMARK GeneRIF: MircoRNA-25-3p in skin precursor cell-induced Schwann cell-derived extracellular vesicles promotes axon regeneration by targeting Tgif1. REFERENCE 3 (bases 1 to 1380) AUTHORS Bolamperti,S., Saito,H., Heerdmann,S., Hesse,E. and Taipaleenmaki,H. TITLE Tgif1-deficiency impairs cytoskeletal architecture in osteoblasts by activating PAK3 signaling JOURNAL Elife 13, 94265 (2024) PUBMED 38661167 REMARK GeneRIF: Tgif1-deficiency impairs cytoskeletal architecture in osteoblasts by activating PAK3 signaling. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1380) AUTHORS Taipaleenmaki,H., Saito,H., Schroder,S., Maeda,M., Mettler,R., Ring,M., Rollmann,E., Gasser,A., Haasper,C., Gehrke,T., Weiss,A., Grimm,S.K. and Hesse,E. TITLE Antagonizing microRNA-19a/b augments PTH anabolic action and restores bone mass in osteoporosis in mice JOURNAL EMBO Mol Med 14 (11), e13617 (2022) PUBMED 36193848 REFERENCE 5 (bases 1 to 1380) AUTHORS Astanina,E., Doronzo,G., Cora,D., Neri,F., Oliviero,S., Genova,T., Mussano,F., Middonti,E., Vallariello,E., Cencioni,C., Valdembri,D., Serini,G., Limana,F., Foglio,E., Ballabio,A. and Bussolino,F. TITLE The TFEB-TGIF1 axis regulates EMT in mouse epicardial cells JOURNAL Nat Commun 13 (1), 5191 (2022) PUBMED 36057632 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1380) AUTHORS Zhang,X., Friedman,A., Heaney,S., Purcell,P. and Maas,R.L. TITLE Meis homeoproteins directly regulate Pax6 during vertebrate lens morphogenesis JOURNAL Genes Dev 16 (16), 2097-2107 (2002) PUBMED 12183364 REFERENCE 7 (bases 1 to 1380) AUTHORS Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S. TITLE Construction of long-transcript enriched cDNA libraries from submicrogram amounts of total RNAs by a universal PCR amplification method JOURNAL Genome Res 11 (9), 1553-1558 (2001) PUBMED 11544199 REFERENCE 8 (bases 1 to 1380) AUTHORS Melhuish,T.A. and Wotton,D. TITLE The interaction of the carboxyl terminus-binding protein with the Smad corepressor TGIF is disrupted by a holoprosencephaly mutation in TGIF JOURNAL J Biol Chem 275 (50), 39762-39766 (2000) PUBMED 10995736 REFERENCE 9 (bases 1 to 1380) AUTHORS Lee,C.K., Klopp,R.G., Weindruch,R. and Prolla,T.A. TITLE Gene expression profile of aging and its retardation by caloric restriction JOURNAL Science 285 (5432), 1390-1393 (1999) PUBMED 10464095 REFERENCE 10 (bases 1 to 1380) AUTHORS Bertolino,E., Wildt,S., Richards,G. and Clerc,R.G. TITLE Expression of a novel murine homeobox gene in the developing cerebellar external granular layer during its proliferation JOURNAL Dev Dyn 205 (4), 410-420 (1996) PUBMED 8901052 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BY096128.1, AK160193.1 and AC079441.37. Transcript Variant: This variant (3) represents use of an alternate promoter and 5' UTR and uses a downstream start codon, compared to variant 1. The resulting isoform (c) has a shorter N-terminus, compared to isoform a. Variants 3, 4, and 5 all encode the same isoform. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK160193.1, SRR7345562.5164007.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 BY096128.1 4-45 43-1371 AK160193.1 2-1330 1372-1380 AC079441.37 216141-216149 c FEATURES Location/Qualifiers source 1..1380 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="17" /map="17 41.87 cM" gene 1..1380 /gene="Tgif1" /gene_synonym="Tgif" /note="TGFB-induced factor homeobox 1" /db_xref="GeneID:21815" /db_xref="MGI:MGI:1194497" exon 1..85 /gene="Tgif1" /gene_synonym="Tgif" /inference="alignment:Splign:2.1.0" exon 86..312 /gene="Tgif1" /gene_synonym="Tgif" /inference="alignment:Splign:2.1.0" CDS 130..888 /gene="Tgif1" /gene_synonym="Tgif" /note="isoform c is encoded by transcript variant 3; homeobox protein TGIF1; 5'-TG-3'-interacting factor 1; TALE family homeobox; TG interacting factor 1" /codon_start=1 /product="homeobox protein TGIF1 isoform c" /protein_id="NP_001157546.1" /db_xref="CCDS:CCDS50174.1" /db_xref="GeneID:21815" /db_xref="MGI:MGI:1194497" /translation="
MDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA"
misc_feature order(175..189,193..195,253..255,271..273,310..312, 316..321,328..333,337..345) /gene="Tgif1" /gene_synonym="Tgif" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(181..183,190..192,319..321,328..333,340..342) /gene="Tgif1" /gene_synonym="Tgif" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 229..345 /gene="Tgif1" /gene_synonym="Tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" exon 313..1380 /gene="Tgif1" /gene_synonym="Tgif" /inference="alignment:Splign:2.1.0" regulatory 1350..1355 /regulatory_class="polyA_signal_sequence" /gene="Tgif1" /gene_synonym="Tgif" /note="hexamer: AATAAA" polyA_site 1374 /gene="Tgif1" /gene_synonym="Tgif" /note="major polyA site" ORIGIN
gcgctccgacttcttaactgcctcgaaaagatttatgcgagcagaaggtgtgcactggcggagttcagctggccttcgcgtcacggtcttgttgcagcatctggcagtgactctgaggatgaagacagcatggacagtcccctggacctttcctcatcagcagcctctggcaagagaaggaggagaggcaatctgcccaaggagtcagtccagattctgcgagactggctgtatgaacacagatacaacgcctatccctcagagcaagagaaagcactgctgtcccagcagacacacctgtccacactacaggtctgtaactggttcatcaacgcccgccgcaggctccttcctgacatgctgagaaaggatggcaaagatccaaatcagttcacgatttcccgccgtggggccaagatttcagaagctagctctattgaagctgcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgtagttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccaggatccattttggctcgcccgtcagtgatctgccataccactgtgactgcattgaaggatgggcctttctctctctgtcagccgattggtgtgggacagagtacagatgtaccgcaaatagcacccagcaactttacagacacctctctcgtgtacccagaggacacttgcaaatctggacccagtccaaaccctcagagtggtcttttcaacactcctccccctactccaccagacctcaaccaggattttagtggattccagcttctagtggatgttgcactcaaacgagcggcagagatggagcttcaggccaaactcacagcttaaccgttttttcaaacaaaacagttctccaaaatacggtcctgattgccgggggtgatggcaagagatgcattattttatatatttttctattaatatttgcacatgggattgctcagacgaagcttcctgttactaagatgtcttaagtggaatagagtcattccaagaactacaaactaaagctactgtagaaacaaagggttttcttttcgaatgtttcttggtagtttctcataatgtgagacggttcccagtatcatgtgatcttctcctccagactcctcttctttatgttccaagactgtgcaatactttagacgccctcgcacctctctcttcccatgtggaatgggacgcccacctacagtctaatgagtaaactttcagttttttgtttgtttgtttttttttagattcaagcaagtatgaatctagttgttggataccttttttcatgatgtaataaagtattttctttaaaagttattgcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]