LOCUS       NM_001024850             760 bp    mRNA    linear   ROD 30-APR-2024
DEFINITION  Mus musculus reproductive homeobox 10 (Rhox10), mRNA.
ACCESSION   NM_001024850 XM_486665
VERSION     NM_001024850.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 760)
  AUTHORS   Tan,K., Song,H.W. and Wilkinson,M.F.
  TITLE     RHOX10 drives mouse spermatogonial stem cell establishment through
            a transcription factor signaling cascade
  JOURNAL   Cell Rep 36 (3), 109423 (2021)
   PUBMED   34289349
  REMARK    GeneRIF: RHOX10 drives mouse spermatogonial stem cell establishment
            through a transcription factor signaling cascade.
REFERENCE   2  (bases 1 to 760)
  AUTHORS   Tan,K., Kim,M.E., Song,H.W., Skarbrevik,D., Babajanian,E.,
            Bedrosian,T.A., Gage,F.H. and Wilkinson,M.F.
  TITLE     The Rhox gene cluster suppresses germline LINE1 transposition
  JOURNAL   Proc Natl Acad Sci U S A 118 (23) (2021)
   PUBMED   34083437
REFERENCE   3  (bases 1 to 760)
  AUTHORS   Xia,X., Zhou,X., Quan,Y., Hu,Y., Xing,F., Li,Z., Xu,B., Xu,C. and
            Zhang,A.
  TITLE     Germline deletion of Cdyl causes teratozoospermia and progressive
            infertility in male mice
  JOURNAL   Cell Death Dis 10 (3), 229 (2019)
   PUBMED   30850578
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 760)
  AUTHORS   Song,H.W., Bettegowda,A., Lake,B.B., Zhao,A.H., Skarbrevik,D.,
            Babajanian,E., Sukhwani,M., Shum,E.Y., Phan,M.H., Plank,T.M.,
            Richardson,M.E., Ramaiah,M., Sridhar,V., de Rooij,D.G., Orwig,K.E.,
            Zhang,K. and Wilkinson,M.F.
  TITLE     The Homeobox Transcription Factor RHOX10 Drives Mouse
            Spermatogonial Stem Cell Establishment
  JOURNAL   Cell Rep 17 (1), 149-164 (2016)
   PUBMED   27681428
  REMARK    GeneRIF: RHOX10 drives mouse spermatogonial stem cell
            establishment.
REFERENCE   5  (bases 1 to 760)
  AUTHORS   Thompson,C.L., Ng,L., Menon,V., Martinez,S., Lee,C.K.,
            Glattfelder,K., Sunkin,S.M., Henry,A., Lau,C., Dang,C.,
            Garcia-Lopez,R., Martinez-Ferre,A., Pombero,A., Rubenstein,J.L.R.,
            Wakeman,W.B., Hohmann,J., Dee,N., Sodt,A.J., Young,R., Smith,K.,
            Nguyen,T.N., Kidney,J., Kuan,L., Jeromin,A., Kaykas,A., Miller,J.,
            Page,D., Orta,G., Bernard,A., Riley,Z., Smith,S., Wohnoutka,P.,
            Hawrylycz,M.J., Puelles,L. and Jones,A.R.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   6  (bases 1 to 760)
  AUTHORS   Song,H.W., Dann,C.T., McCarrey,J.R., Meistrich,M.L., Cornwall,G.A.
            and Wilkinson,M.F.
  TITLE     Dynamic expression pattern and subcellular localization of the
            Rhox10 homeobox transcription factor during early germ cell
            development
  JOURNAL   Reproduction 143 (5), 611-624 (2012)
   PUBMED   22393026
  REMARK    GeneRIF: RHOX10 protein is selectively expressed in fetal
            gonocytes, germline stem cells, spermatogonia, and early
            spermatocytes and undergoes shift in subcellular location as cell
            develop.
REFERENCE   7  (bases 1 to 760)
  AUTHORS   Daggag,H., Svingen,T., Western,P.S., van den Bergen,J.A.,
            McClive,P.J., Harley,V.R., Koopman,P. and Sinclair,A.H.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   8  (bases 1 to 760)
  AUTHORS   Maclean,J.A. 2nd, Chen,M.A., Wayne,C.M., Bruce,S.R., Rao,M.,
            Meistrich,M.L., Macleod,C. and Wilkinson,M.F.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DQ058647.1 and AK146090.1.
            
            On Apr 7, 2006 this sequence version replaced NM_001024850.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058647.1, BC100366.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-746               DQ058647.1         1-746
            747-760             AK146090.1         729-742
FEATURES             Location/Qualifiers
     source          1..760
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 22.32 cM"
     gene            1..760
                     /gene="Rhox10"
                     /note="reproductive homeobox 10"
                     /db_xref="GeneID:434769"
                     /db_xref="MGI:MGI:3580249"
     exon            1..472
                     /gene="Rhox10"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    75..77
                     /gene="Rhox10"
                     /note="upstream in-frame stop codon"
     CDS             123..713
                     /gene="Rhox10"
                     /note="reproductive homeobox on X chromosome 10"
                     /codon_start=1
                     /product="reproductive homeobox on chromosome X, 10"
                     /protein_id="NP_001020021.1"
                     /db_xref="CCDS:CCDS40945.1"
                     /db_xref="GeneID:434769"
                     /db_xref="MGI:MGI:3580249"
                     /translation="

MESKYFYFDLDYYGVSFYEEVIMTESQQRAAARAAQCRFGRGVRDLHELGQDDHPTFKYTQTYSSETRKETQARPKEPEKAAGAVSRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYRRKQKELLLSNATSGTSNNFSAQMNEDPKSSTSVPEEQIGFIVCQQHLGKSCWS"

     misc_feature    402..554
                     /gene="Rhox10"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            473..518
                     /gene="Rhox10"
                     /inference="alignment:Splign:2.1.0"
     exon            519..760
                     /gene="Rhox10"
                     /inference="alignment:Splign:2.1.0"
     polyA_site      760
                     /gene="Rhox10"
                     /note="putative"
ORIGIN      

tccgtgcctaagtttagccacacccaggagctagttaggtgaatagtgtgggacatgcgcaggattttagcccgtgaactaggaggtgctccagagtaggctccatctgcaaagctctagcaatggagagcaaatacttctacttcgacctcgattattatggggtaagcttctatgaggaagtaataatgactgaatctcagcagagggctgcggccagggcagcccaatgtcgctttggaagaggtgtaagagacctgcacgagctgggccaggacgaccacccgacctttaaatacacgcaaacctacagctctgaaacaagaaaggaaactcaagcccgtcccaaagagcccgagaaagcagcgggagcagtttctcgtcgctccaacagcaagaagtacaccaatgcccaaatgtgtgaactagagaaggctttccaagagacccagtatcctgatgcacaccaaagaaaagcacttgcaaaacttattgatgtggacgaatgcaaggtgaaggcttggtttaaatataagagagctaaatacaggagaaaacaaaaggagttactactcagcaatgctacatctggaacctcgaacaacttttcggctcagatgaatgaagaccccaagagtagtacctctgttcctgaggagcaaatagggttcattgtgtgccagcaacatcttggcaaatcctgctggtcatgaagatattgttttgtcacatataatagcaataaaggagatgttcatcc

//