2024-05-21 23:29:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_013559232 474 bp mRNA linear INV 28-FEB-2018 DEFINITION PREDICTED: Lingula anatina protein FAM84B-like (LOC106176727), mRNA. ACCESSION XM_013559232 VERSION XM_013559232.1 DBLINK BioProject: PRJNA293030 KEYWORDS RefSeq; includes ab initio. SOURCE Lingula anatina ORGANISM Lingula anatina Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Brachiopoda; Linguliformea; Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019775411.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Lingula anatina Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..474 /organism="Lingula anatina" /mol_type="mRNA" /isolate="Amm_Jpn" /isolation_source="intertidal zone" /db_xref="taxon:7574" /chromosome="Unknown" /sex="male" /tissue_type="Gonads" /dev_stage="adult" /country="Japan: Amami, Kasari Bay" /lat_lon="28.4406 N 129.6676 E" /collection_date="2012" /collected_by="Nori Satoh, Kazuyoshi Endo" /identified_by="Kazuyoshi Endo" gene 1..474 /gene="LOC106176727" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106176727" CDS 1..474 /gene="LOC106176727" /codon_start=1 /product="protein FAM84B-like" /protein_id="XP_013414686.1" /db_xref="GeneID:106176727" /translation="
MEDVRRHNQAVLDSLVPGDLVEFQRSWLFSHWAVYIGNEEVVHFIERNSGGVFSSSSERSMTGVVRRDSFWTVAGRSKAFKNNRRDAKYSCDVIVTRALSKLGVSEFNLFLRNSEHFVAWCRYGEECSEQAQTIWTMFLGSMAVIVGGIAALTGLRR"
misc_feature 82..375 /gene="LOC106176727" /note="Lecithin retinol acyltransferase; Region: LRAT; pfam04970" /db_xref="CDD:398571" ORIGIN
atggaagacgtgaggcgtcataaccaggcagtgttagattcccttgtgccgggagacctggtggagttccaaaggtcgtggctcttctcccactgggccgtttatattggtaatgaagaagtggtccattttattgaacgcaattcaggaggtgtcttcagttcctctagtgagcgttctatgacgggggtagttcgaagggattccttttggacagtggcagggaggagtaaggcgttcaaaaacaacagaagggacgccaaatacagctgtgatgtgatagtgacgagggctctgtcaaagctgggagtgagcgagttcaatctcttcttgagaaatagtgaacattttgtagcctggtgtagatatggtgaagagtgcagtgaacaggcacaaaccatctggacaatgtttttggggtctatggctgtaattgtggggggcattgccgcactcactggccttaggcgatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]