2024-05-21 23:41:22, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001166313 972 bp mRNA linear MAM 20-FEB-2022 DEFINITION Sus scrofa cyclin H (CCNH), mRNA. ACCESSION NM_001166313 VERSION NM_001166313.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. REFERENCE 1 (bases 1 to 972) AUTHORS Fujii W, Nishimura T, Kano K, Sugiura K and Naito K. TITLE CDK7 and CCNH are components of CDK-activating kinase and are required for meiotic progression of pig oocytes JOURNAL Biol. Reprod. 85 (6), 1124-1132 (2011) PUBMED 21778139 REMARK GeneRIF: CDK7 and CCNH activate CDC2 by T161 phosphorylation and make up CDK-activating kinase, which is required for normal meiotic progression during porcine oocyte maturation. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB499892.1. ##Evidence-Data-START## Transcript exon combination :: AB499892.1, SRR5275317.44162.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103886115 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..972 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="2" /map="2" gene 1..972 /gene="CCNH" /note="cyclin H" /db_xref="GeneID:100310796" /db_xref="VGNC:VGNC:86359" CDS 1..972 /gene="CCNH" /codon_start=1 /product="cyclin-H" /protein_id="NP_001159785.1" /db_xref="GeneID:100310796" /db_xref="VGNC:VGNC:86359" /translation="
MYHNSSQKRHWTFASEEQLARLRADANRKFRCKAVANGKVLPNDPIFLEPHEEMILCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPMLENPEILRKTADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVDSL"
misc_feature 4..924 /gene="CCNH" /note="cyclin ccl1; Region: ccl1; TIGR00569" /db_xref="CDD:129660" exon 1..117 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 118..240 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 241..314 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 315..525 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 526..689 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 690..760 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 761..872 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 873..933 /gene="CCNH" /inference="alignment:Splign:2.1.0" exon 934..972 /gene="CCNH" /inference="alignment:Splign:2.1.0" ORIGIN
atgtaccacaatagtagccagaagcggcactggactttcgccagtgaggagcagctagcccggttgcgggccgacgccaaccgcaaattcagatgcaaagcagtggcgaatgggaaggttcttccaaatgacccaatctttcttgagcctcatgaagaaatgatactctgcaaatactatgagaaaagattattggaattctgttcagtgtttaagccagcaatgccaaggtctgttgtgggtacggcttgtatgtatttcaagcgtttttatcttaataactcagttatggaatatcacccccggataataatgctcacttgtgcatttttggcctgcaaggtagatgaattcaatgtatctagtccacaatttgttggaaatctgcgggagagtcctcttggacaagagaaagcacttgaacagattttggaatatgaactgctccttatacaacagcttaatttccaccttattgtccacaatccttatagaccttttgagggctttctcattgatttaaagactcgatatcccatgttggagaatccagagattttgaggaagacagctgatgactttctcagtagagttgcattgacggatgctcaccttttatacacaccttcccagattgccctgactgccattttatctagtgcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaagagaacagaactagcctgtcacagttactagatattatgaaaagcatgagaaacttggtaaaaaaatatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagagatgtcactctcctgagcttgcacttaacgtaattaccaagaagaggaaaggttatgaagatgatgattatgtctcaaagaaatccaaacatgaggaggaagaatggactgatgatgacctggtagattccctgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]