2024-06-29 21:40:55, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS XM_046906228 475 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus U1 small nuclear ribonucleoprotein A-like (LOC121108975), mRNA. ACCESSION XM_046906228 VERSION XM_046906228.1 DBLINK BioProject: PRJNA698609 KEYWORDS RefSeq; corrected model. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024096096.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 JAENSK010000669.1 2782-2821 c 41-122 JAENSK010000669.1 2420-2501 c 123-295 JAENSK010000669.1 1642-1814 c 296-310 JAENSK010000669.1 260-274 c 311-311 "N" 1-1 312-475 JAENSK010000669.1 96-259 c FEATURES Location/Qualifiers source 1..475 /organism="Gallus gallus" /mol_type="mRNA" /isolate="bGalGal1" /db_xref="taxon:9031" /chromosome="Unknown" /sex="female" /tissue_type="blood" /country="USA: Fayetteville" /lat_lon="36.0822 N 94.1719 W" /collection_date="20-May-2019" /collected_by="Nick Anthony" gene 1..475 /gene="LOC121108975" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 long SRA reads, 1 Protein, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 91 samples with support for all annotated introns" /db_xref="CGNC:88847" /db_xref="GeneID:121108975" misc_feature 1 /gene="LOC121108975" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 50..472 /gene="LOC121108975" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: U1 small nuclear ribonucleoprotein A-like" /protein_id="XP_046762184.1" /db_xref="GeneID:121108975" /db_xref="CGNC:88847" /translation="
MAVQEARPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEMGSATNALRSMQGFPFYDKPMRIQYAXTDSDIIAKMKGTFVERDRKREKRKPKGSDAPPPKKNPPPGAAAPVRKAQSSH"
misc_feature 68..334 /gene="LOC121108975" /note="RNA recognition motif 1 (RRM1) found in vertebrate U1 small nuclear ribonucleoprotein A (U1A); Region: RRM1_U1A; cd12477" /db_xref="CDD:409906" misc_feature order(86..88,92..97,104..106,179..181,185..187,191..211, 215..217,287..289,296..298,302..325) /gene="LOC121108975" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:409906" ORIGIN
gggcgggcacaacgcgcgaggcgcgagcgaagaggaggcgcgcagagcaatggcggtgcaggaggcgcgtcccaaccacaccatttacatcaataacctgaacgagaagatcaagaaggatgagctgaagaagtcgctgtacgccatcttctcgcagttcgggcagatcctggacatcctggtgtcccgcagcctgaagatgagggggcaggccttcgtcatcttcaaggagatgggcagcgccaccaacgcgctgcgctccatgcagggcttccccttctacgacaagcccatgcgcatccaatacgccnaaacggactcagacatcatagccaaaatgaagggcacttttgtggagcgcgaccggaagagggagaaaaggaaacccaaagggagcgacgccccccccccaaaaaagaacccccccccgggggcggccgcaccggtacggaaagctcagagcagccattaatgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]