2025-07-13 15:57:00, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_015288526 1929 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus Uncharacterized protein (RP11-400G3.5), mRNA. ACCESSION XM_015288526 VERSION XM_015288526.4 DBLINK BioProject: PRJNA698609 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052537.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Mar 1, 2022 this sequence version replaced XM_015288526.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1929 /organism="Gallus gallus" /mol_type="mRNA" /isolate="bGalGal1" /db_xref="taxon:9031" /chromosome="6" /sex="female" /tissue_type="blood" /geo_loc_name="USA: Fayetteville" /lat_lon="36.0822 N 94.1719 W" /collection_date="20-May-2019" /collected_by="Nick Anthony" gene 1..1929 /gene="RP11-400G3.5" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 ESTs, 2533 long SRA reads, 55 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="CGNC:65060" /db_xref="GeneID:100858007" misc_feature 1 /gene="RP11-400G3.5" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 30..1514 /gene="RP11-400G3.5" /codon_start=1 /product="cytochrome P450 2C9-like" /protein_id="XP_015144012.2" /db_xref="GeneID:100858007" /db_xref="CGNC:65060" /translation="
MLLLGAASVVLLVCVACLLSIVQWRKRTGKGKMPEGPTPLPIVGNILEVKPKNLAKTLEKLAEKYGPVFSVQLGSTPVVVLSGYEAVKEALIDRADEFAARGHMPIGDRTNKGLGIIFSNNEGWLHVRRFALSTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRLPFDPTFKLSCAVSNVICSIVFGKRYDYKDKKFLSLMNNMNNMFEMMNSRWGQLYQMFSYVLDYLPGPHNNIFKEMDAVKAFVAEEVKLHQASLDPSAPQDFIDCFLSKMQEEKDNPKSHFHMTNLITSTFDLFIAGTETTSTTTRYGLLLLLKYPKIQEKVQEEIDRVVGRSRRPCVADRTQMPYTDAVVHEIQRFITLIPTSLPHAVTKDIHFRDYIIPKGTTVMPLLSTALYDSKEFPNPTEFNPGHFLNQNGTFRKSDFFIPFSAGKRICPGEGLARMEIFLLLTAILQNFTLKPVISPEELSITPTLSGTGNVPPYYQLCAIPR"
misc_feature 222..1496 /gene="RP11-400G3.5" /note="cytochrome P450 (CYP) superfamily; Region: cytochrome_P450; cl41757" /db_xref="CDD:477761" misc_feature order(399..401,411..413,432..434,573..575,918..923, 930..935,942..947,954..956,1107..1109,1137..1139, 1143..1145,1212..1214,1320..1328,1338..1352,1359..1364) /gene="RP11-400G3.5" /note="heme binding site [chemical binding]; other site" /db_xref="CDD:410651" misc_feature order(651..656,918..920,927..932,942..944,1131..1142) /gene="RP11-400G3.5" /note="chemical substrate binding pocket [chemical binding]; other site" /db_xref="CDD:410651" polyA_site 1929 /gene="RP11-400G3.5" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
gcactcagaaactcgtgcccacgtgggagatgttgctcctgggagcagcgagtgtggtcctcctggtttgtgttgcttgcctgctctccatcgtgcaatggagaaaaaggactggaaaggggaagatgcctgagggaccaactccccttcccatcgtagggaacatactggaggtgaaaccaaagaatttagccaaaacccttgagaagctcgctgagaaatatgggcccgtcttctcagtgcaactgggttcaactccagtagtggtgctatctggatatgaggcggtgaaagaagccttgattgatcgtgcggatgagtttgctgccagaggacacatgcctatcggggaccggactaacaaaggattaggcattatattcagcaacaacgagggatggttacacgttcggcggtttgctctcagcactctgcgcaactttgggatggggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatcacaaaaacaaagagactgccctttgacccaacattcaagttgagctgcgctgtctccaacgtcatatgctccattgtctttgggaagcgatatgactataaagacaagaagttcctgtccctgatgaacaacatgaacaacatgtttgagatgatgaactcccgctggggacagttataccagatgttctcctacgttctggattatttgcctggcccacataacaatatattcaaagaaatggatgctgtaaaagcctttgtggcagaagaggtaaagctgcaccaagcctccctggatcccagcgctccccaggatttcattgactgcttcctcagcaaaatgcaggaggaaaaagacaatcccaaatcacacttccacatgacaaacctgataacgtccaccttcgacttgttcattgctggaacggagacaacaagcaccaccacacgatacgggcttctgcttcttctcaaatatcccaagatacaagagaaagttcaagaagagattgaccgggtagtaggacgatcacgaagaccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccacgaaatccagcgcttcatcaccctcatccctacgagcctccctcatgctgtgaccaaagacatccacttcagagactacatcattcccaagggcaccacagtcatgcccctcctcagtactgcactctatgacagcaaggagtttccaaacccaaccgagtttaatcctggacatttcttgaaccagaatggcacctttaggaagagcgacttcttcattcccttctcagcagggaaacgcatttgccctggagagggcctggcacgcatggagatattcttactcctgaccgccatcctgcagaacttcaccttgaagcctgtcatcagccctgaggaactcagcatcacccctacactgagtgggacaggaaatgttcctccctactaccagctctgtgctatcccccgctgaggggcacaaaacctcactgctgtgctcctcagccagactgctcctttacaccttcccaactcaaaccagtggcaggagcgttgccccaccaacccaaagcctccacatgacagcccgcagacaaagtcccaggcagatcaaacccggatactttgaacacctccctgaactgctcctcctcaccacagcgcagaaggtaatgatgcacctcactgcagtgacattctgtgcatgtgctccctgagcacagcagtcccactgaacagctgatttgctcacagctgtgactccatggctgtccatcccctgcttctagggctgtatgtgtcccacccagagcagcacactttgcacagtgactgtgttgcgtatgtgtatgctaacgacccaataaagagcaatctatttaggagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]