GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-22 15:36:21, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_015288526            1929 bp    mRNA    linear   VRT 01-MAR-2022
DEFINITION  PREDICTED: Gallus gallus Uncharacterized protein (RP11-400G3.5),
            mRNA.
ACCESSION   XM_015288526
VERSION     XM_015288526.4
DBLINK      BioProject: PRJNA698609
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052537.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Mar 1, 2022 this sequence version replaced XM_015288526.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gallus gallus Annotation Release 106
            Annotation Version          :: 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1929
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /isolate="bGalGal1"
                     /db_xref="taxon:9031"
                     /chromosome="6"
                     /sex="female"
                     /tissue_type="blood"
                     /geo_loc_name="USA: Fayetteville"
                     /lat_lon="36.0822 N 94.1719 W"
                     /collection_date="20-May-2019"
                     /collected_by="Nick Anthony"
     gene            1..1929
                     /gene="RP11-400G3.5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 ESTs, 2533 long SRA reads, 55
                     Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 27 samples with
                     support for all annotated introns"
                     /db_xref="CGNC:65060"
                     /db_xref="GeneID:100858007"
     misc_feature    1
                     /gene="RP11-400G3.5"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             30..1514
                     /gene="RP11-400G3.5"
                     /codon_start=1
                     /product="cytochrome P450 2C9-like"
                     /protein_id="XP_015144012.2"
                     /db_xref="GeneID:100858007"
                     /db_xref="CGNC:65060"
                     /translation="
MLLLGAASVVLLVCVACLLSIVQWRKRTGKGKMPEGPTPLPIVGNILEVKPKNLAKTLEKLAEKYGPVFSVQLGSTPVVVLSGYEAVKEALIDRADEFAARGHMPIGDRTNKGLGIIFSNNEGWLHVRRFALSTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRLPFDPTFKLSCAVSNVICSIVFGKRYDYKDKKFLSLMNNMNNMFEMMNSRWGQLYQMFSYVLDYLPGPHNNIFKEMDAVKAFVAEEVKLHQASLDPSAPQDFIDCFLSKMQEEKDNPKSHFHMTNLITSTFDLFIAGTETTSTTTRYGLLLLLKYPKIQEKVQEEIDRVVGRSRRPCVADRTQMPYTDAVVHEIQRFITLIPTSLPHAVTKDIHFRDYIIPKGTTVMPLLSTALYDSKEFPNPTEFNPGHFLNQNGTFRKSDFFIPFSAGKRICPGEGLARMEIFLLLTAILQNFTLKPVISPEELSITPTLSGTGNVPPYYQLCAIPR"
     misc_feature    222..1496
                     /gene="RP11-400G3.5"
                     /note="cytochrome P450 (CYP) superfamily; Region:
                     cytochrome_P450; cl41757"
                     /db_xref="CDD:477761"
     misc_feature    order(399..401,411..413,432..434,573..575,918..923,
                     930..935,942..947,954..956,1107..1109,1137..1139,
                     1143..1145,1212..1214,1320..1328,1338..1352,1359..1364)
                     /gene="RP11-400G3.5"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:410651"
     misc_feature    order(651..656,918..920,927..932,942..944,1131..1142)
                     /gene="RP11-400G3.5"
                     /note="chemical substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:410651"
     polyA_site      1929
                     /gene="RP11-400G3.5"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
gcactcagaaactcgtgcccacgtgggagatgttgctcctgggagcagcgagtgtggtcctcctggtttgtgttgcttgcctgctctccatcgtgcaatggagaaaaaggactggaaaggggaagatgcctgagggaccaactccccttcccatcgtagggaacatactggaggtgaaaccaaagaatttagccaaaacccttgagaagctcgctgagaaatatgggcccgtcttctcagtgcaactgggttcaactccagtagtggtgctatctggatatgaggcggtgaaagaagccttgattgatcgtgcggatgagtttgctgccagaggacacatgcctatcggggaccggactaacaaaggattaggcattatattcagcaacaacgagggatggttacacgttcggcggtttgctctcagcactctgcgcaactttgggatggggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatcacaaaaacaaagagactgccctttgacccaacattcaagttgagctgcgctgtctccaacgtcatatgctccattgtctttgggaagcgatatgactataaagacaagaagttcctgtccctgatgaacaacatgaacaacatgtttgagatgatgaactcccgctggggacagttataccagatgttctcctacgttctggattatttgcctggcccacataacaatatattcaaagaaatggatgctgtaaaagcctttgtggcagaagaggtaaagctgcaccaagcctccctggatcccagcgctccccaggatttcattgactgcttcctcagcaaaatgcaggaggaaaaagacaatcccaaatcacacttccacatgacaaacctgataacgtccaccttcgacttgttcattgctggaacggagacaacaagcaccaccacacgatacgggcttctgcttcttctcaaatatcccaagatacaagagaaagttcaagaagagattgaccgggtagtaggacgatcacgaagaccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccacgaaatccagcgcttcatcaccctcatccctacgagcctccctcatgctgtgaccaaagacatccacttcagagactacatcattcccaagggcaccacagtcatgcccctcctcagtactgcactctatgacagcaaggagtttccaaacccaaccgagtttaatcctggacatttcttgaaccagaatggcacctttaggaagagcgacttcttcattcccttctcagcagggaaacgcatttgccctggagagggcctggcacgcatggagatattcttactcctgaccgccatcctgcagaacttcaccttgaagcctgtcatcagccctgaggaactcagcatcacccctacactgagtgggacaggaaatgttcctccctactaccagctctgtgctatcccccgctgaggggcacaaaacctcactgctgtgctcctcagccagactgctcctttacaccttcccaactcaaaccagtggcaggagcgttgccccaccaacccaaagcctccacatgacagcccgcagacaaagtcccaggcagatcaaacccggatactttgaacacctccctgaactgctcctcctcaccacagcgcagaaggtaatgatgcacctcactgcagtgacattctgtgcatgtgctccctgagcacagcagtcccactgaacagctgatttgctcacagctgtgactccatggctgtccatcccctgcttctagggctgtatgtgtcccacccagagcagcacactttgcacagtgactgtgttgcgtatgtgtatgctaacgacccaataaagagcaatctatttaggagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]