ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-22 15:36:21, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_015288526 1929 bp mRNA linear VRT 01-MAR-2022
DEFINITION PREDICTED: Gallus gallus Uncharacterized protein (RP11-400G3.5),
mRNA.
ACCESSION XM_015288526
VERSION XM_015288526.4
DBLINK BioProject: PRJNA698609
KEYWORDS RefSeq.
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_052537.1) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
On Mar 1, 2022 this sequence version replaced XM_015288526.3.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Gallus gallus Annotation Release 106
Annotation Version :: 106
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 9.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1929
/organism="Gallus gallus"
/mol_type="mRNA"
/isolate="bGalGal1"
/db_xref="taxon:9031"
/chromosome="6"
/sex="female"
/tissue_type="blood"
/geo_loc_name="USA: Fayetteville"
/lat_lon="36.0822 N 94.1719 W"
/collection_date="20-May-2019"
/collected_by="Nick Anthony"
gene 1..1929
/gene="RP11-400G3.5"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 6 ESTs, 2533 long SRA reads, 55
Proteins, and 100% coverage of the annotated genomic
feature by RNAseq alignments, including 27 samples with
support for all annotated introns"
/db_xref="CGNC:65060"
/db_xref="GeneID:100858007"
misc_feature 1
/gene="RP11-400G3.5"
/experiment="COORDINATES: cap analysis [ECO:0007248]"
/note="transcription start site"
CDS 30..1514
/gene="RP11-400G3.5"
/codon_start=1
/product="cytochrome P450 2C9-like"
/protein_id="XP_015144012.2"
/db_xref="GeneID:100858007"
/db_xref="CGNC:65060"
/translation="
MLLLGAASVVLLVCVACLLSIVQWRKRTGKGKMPEGPTPLPIVGNILEVKPKNLAKTLEKLAEKYGPVFSVQLGSTPVVVLSGYEAVKEALIDRADEFAARGHMPIGDRTNKGLGIIFSNNEGWLHVRRFALSTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRLPFDPTFKLSCAVSNVICSIVFGKRYDYKDKKFLSLMNNMNNMFEMMNSRWGQLYQMFSYVLDYLPGPHNNIFKEMDAVKAFVAEEVKLHQASLDPSAPQDFIDCFLSKMQEEKDNPKSHFHMTNLITSTFDLFIAGTETTSTTTRYGLLLLLKYPKIQEKVQEEIDRVVGRSRRPCVADRTQMPYTDAVVHEIQRFITLIPTSLPHAVTKDIHFRDYIIPKGTTVMPLLSTALYDSKEFPNPTEFNPGHFLNQNGTFRKSDFFIPFSAGKRICPGEGLARMEIFLLLTAILQNFTLKPVISPEELSITPTLSGTGNVPPYYQLCAIPR"
misc_feature 222..1496
/gene="RP11-400G3.5"
/note="cytochrome P450 (CYP) superfamily; Region:
cytochrome_P450; cl41757"
/db_xref="CDD:477761"
misc_feature order(399..401,411..413,432..434,573..575,918..923,
930..935,942..947,954..956,1107..1109,1137..1139,
1143..1145,1212..1214,1320..1328,1338..1352,1359..1364)
/gene="RP11-400G3.5"
/note="heme binding site [chemical binding]; other site"
/db_xref="CDD:410651"
misc_feature order(651..656,918..920,927..932,942..944,1131..1142)
/gene="RP11-400G3.5"
/note="chemical substrate binding pocket [chemical
binding]; other site"
/db_xref="CDD:410651"
polyA_site 1929
/gene="RP11-400G3.5"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
gcactcagaaactcgtgcccacgtgggagatgttgctcctgggagcagcgagtgtggtcctcctggtttgtgttgcttgcctgctctccatcgtgcaatggagaaaaaggactggaaaggggaagatgcctgagggaccaactccccttcccatcgtagggaacatactggaggtgaaaccaaagaatttagccaaaacccttgagaagctcgctgagaaatatgggcccgtcttctcagtgcaactgggttcaactccagtagtggtgctatctggatatgaggcggtgaaagaagccttgattgatcgtgcggatgagtttgctgccagaggacacatgcctatcggggaccggactaacaaaggattaggcattatattcagcaacaacgagggatggttacacgttcggcggtttgctctcagcactctgcgcaactttgggatggggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatcacaaaaacaaagagactgccctttgacccaacattcaagttgagctgcgctgtctccaacgtcatatgctccattgtctttgggaagcgatatgactataaagacaagaagttcctgtccctgatgaacaacatgaacaacatgtttgagatgatgaactcccgctggggacagttataccagatgttctcctacgttctggattatttgcctggcccacataacaatatattcaaagaaatggatgctgtaaaagcctttgtggcagaagaggtaaagctgcaccaagcctccctggatcccagcgctccccaggatttcattgactgcttcctcagcaaaatgcaggaggaaaaagacaatcccaaatcacacttccacatgacaaacctgataacgtccaccttcgacttgttcattgctggaacggagacaacaagcaccaccacacgatacgggcttctgcttcttctcaaatatcccaagatacaagagaaagttcaagaagagattgaccgggtagtaggacgatcacgaagaccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccacgaaatccagcgcttcatcaccctcatccctacgagcctccctcatgctgtgaccaaagacatccacttcagagactacatcattcccaagggcaccacagtcatgcccctcctcagtactgcactctatgacagcaaggagtttccaaacccaaccgagtttaatcctggacatttcttgaaccagaatggcacctttaggaagagcgacttcttcattcccttctcagcagggaaacgcatttgccctggagagggcctggcacgcatggagatattcttactcctgaccgccatcctgcagaacttcaccttgaagcctgtcatcagccctgaggaactcagcatcacccctacactgagtgggacaggaaatgttcctccctactaccagctctgtgctatcccccgctgaggggcacaaaacctcactgctgtgctcctcagccagactgctcctttacaccttcccaactcaaaccagtggcaggagcgttgccccaccaacccaaagcctccacatgacagcccgcagacaaagtcccaggcagatcaaacccggatactttgaacacctccctgaactgctcctcctcaccacagcgcagaaggtaatgatgcacctcactgcagtgacattctgtgcatgtgctccctgagcacagcagtcccactgaacagctgatttgctcacagctgtgactccatggctgtccatcccctgcttctagggctgtatgtgtcccacccagagcagcacactttgcacagtgactgtgttgcgtatgtgtatgctaacgacccaataaagagcaatctatttaggagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]