GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-29 20:32:11, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_004936277            2071 bp    mRNA    linear   VRT 01-MAR-2022
DEFINITION  PREDICTED: Gallus gallus ring finger protein 24 (RNF24), transcript
            variant X3, mRNA.
ACCESSION   XM_004936277
VERSION     XM_004936277.5
DBLINK      BioProject: PRJNA698609
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052535.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Mar 1, 2022 this sequence version replaced XM_004936277.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gallus gallus Annotation Release 106
            Annotation Version          :: 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2071
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /isolate="bGalGal1"
                     /db_xref="taxon:9031"
                     /chromosome="4"
                     /sex="female"
                     /tissue_type="blood"
                     /country="USA: Fayetteville"
                     /lat_lon="36.0822 N 94.1719 W"
                     /collection_date="20-May-2019"
                     /collected_by="Nick Anthony"
     gene            1..2071
                     /gene="RNF24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 mRNAs, 79 long SRA reads, 6
                     Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 42 samples with
                     support for all annotated introns"
                     /db_xref="CGNC:65426"
                     /db_xref="GeneID:100857605"
     misc_feature    1
                     /gene="RNF24"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             448..915
                     /gene="RNF24"
                     /codon_start=1
                     /product="RING finger protein 24 isoform X3"
                     /protein_id="XP_004936334.1"
                     /db_xref="GeneID:100857605"
                     /db_xref="CGNC:65426"
                     /translation="
MEGKSLPMSSDFQHYSFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKELYAYKQVILKEKVKELNLHEICAVCLEEFKPKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDPGPPQGPLPGAENIV"
     misc_feature    694..852
                     /gene="RNF24"
                     /note="RING finger, H2 subclass, found in RING finger
                     protein 24 (RNF24) and similar proteins; Region:
                     RING-H2_RNF24; cd16675"
                     /db_xref="CDD:438337"
     polyA_site      2071
                     /gene="RNF24"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
acacatggtttgttttgcagctttcgtgctccctgcatcactgcttttgcgagcaggacgagaccggagcaaagggctcatttgtttccctgctctctccttctgctctgctaatgtgggaagcagccaagcccaacttcgtctggtttttattaccgtggaggatcaggctgcagggatcgggctgcttttaactcacaaagcacccggcaggaaaccacgccagttcccaagcagcgagagagaaactgaaagctgtcggccaggagagcaaccccgtgtttattttagccatttcccaacactggctgcttggaaatagcagtgtgtttcgcagctccctggctaggaagagcatttttgggggaaaaaaaaataaaaaaccagcaacgaacagctctggggctggagcagaacagggaggtggattttgacctatctggcaggatggaaggcaaaagcctacccatgagctcagatttccagcattacagtttcaggatgccgaacatcgggttccagaacctgcctctcaacatatatatcgtggtttttggcacggccatcttcgtcttcatcctcagtttactgttctgttgctacttgatcaggcttagacatcaagcacacaaagagctttacgcctacaaacaggtaatactcaaggagaaggtgaaggagttgaacctacatgagatctgcgccgtttgcttggaggagttcaagcccaaggacgagttggggatctgcccatgcaaacatgccttccacagaaagtgcctcatcaaatggctggaggtgcgcaaggtgtgcccgctctgcaacatgccggtgctgcagctggcacagctgcacagcaagcaggaccccggccccccccagggccccctccccggagcagagaacattgtatagctctgtgccagcacggactgccccggggctgctggggggtacccggagacgaccaaagcactacggcaccagcaaggagccaagctggggacaggaggatggagagctgagagcactttagggaaggagcatccccatgccccaaaagggtgcttggccttggaatggggttttcctcgctgggaacgtggagctcagtgactgttgggaagcctcagcatgatgccttgggatggagcggccgagcggtgcctgaatgcactcaactccctctgagcatcacccaggagagccggtgtccgccccgcgcagtgctgtggggtcagtgccatccaaggggggaattttcacccctggttgcgatctctactgaggattgcagtttcttctcccaaagggctgcccagggcttggagctgggtgctttttggggtggctccccccccaccctgctcggtgccatgggctacctcagggcttccttcatccctgccatgggtaagagcatctcccatcggtgcaaccacctcagtatcacagcatggtgggggcaaaccctaccctttgggttcacgttgagcctggccctttgggtatccaagcacggatggctcagcaccacccaaagtccccacccaaccctccctgagtgccaaagctgctgtgggctgcaccaccccttcctctcccttcatcccatggggcaaattcagcccctttccaggcatcattcccccctcaaccacgcagttctttatgggagggggttccagtgttaccccacagcggggctgggtgggctctgagggggtccctcctgtacataccccacaactcccaagactgtttatggagcgtggagcctcatagacatgtttgtacactacaaattctgcagcagaatatttttttaaaaacgtttgctgttttcctttttttttggggggggggagggagtattttttttgttgttttggggcttttttttttgtaagctctatttttgtatatttaattgctatttcaagattctaatgcgtctttttttgctaatcacactattcttaaggaaaaaaaaaaaaaaagcaaagcaaaggaggagagaagtggtttgcatgtgatttgacttgaaatgtaaataaaggcaggttttgga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]