LOCUS       NM_205379               1610 bp    mRNA    linear   VRT 06-AUG-2024
DEFINITION  Gallus gallus TGFB induced factor homeobox 1 (TGIF1), mRNA.
ACCESSION   NM_205379
VERSION     NM_205379.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1610)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1610)
  AUTHORS   Lorda-Diez,C.I., Montero,J.A., Sanchez-Fernandez,C.,
            Garcia-Porrero,J.A., Chimal-Monroy,J. and Hurle,J.M.
  TITLE     Four and a half domain 2 (FHL2) scaffolding protein is a marker of
            connective tissues of developing digits and regulates fibrogenic
            differentiation of limb mesodermal progenitors
  JOURNAL   J Tissue Eng Regen Med 12 (4), e2062-e2072 (2018)
   PUBMED   29330921
  REMARK    GeneRIF: Gain-of-function and loss-of-function experiments in the
            micromass culture assay revealed a positive transcriptional
            influence of Fhl2 in the expression of TGIF1.
REFERENCE   3  (bases 1 to 1610)
  AUTHORS   Lorda-Diez,C.I., Montero,J.A., Martinez-Cue,C., Garcia-Porrero,J.A.
            and Hurle,J.M.
  TITLE     Transforming growth factors beta coordinate cartilage and tendon
            differentiation in the developing limb mesenchyme
  JOURNAL   J Biol Chem 284 (43), 29988-29996 (2009)
   PUBMED   19717568
  REMARK    GeneRIF: Tgif1 gene regulation by TGFbeta signaling correlated with
            the differential chondrogenic and fibrogenic effects of this
            pathway. In functional experiments, Tgif1 reproduces the
            profibrogenic effect of TGFbeta treatments.
REFERENCE   4  (bases 1 to 1610)
  AUTHORS   Dong,Y.F., Soung do,Y., Chang,Y., Enomoto-Iwamoto,M., Paris,M.,
            O'Keefe,R.J., Schwarz,E.M. and Drissi,H.
  TITLE     Transforming growth factor-beta and Wnt signals regulate
            chondrocyte differentiation through Twist1 in a stage-specific
            manner
  JOURNAL   Mol Endocrinol 21 (11), 2805-2820 (2007)
   PUBMED   17684115
  REMARK    GeneRIF: Twist1 may be an important regulator of chondrocyte
            progression toward terminal maturation in response to TGF-beta and
            canonical Wnt signaling
REFERENCE   5  (bases 1 to 1610)
  AUTHORS   Ryan,A.K., Tejada,M.L., May,D.L., Dubaova,M. and Deeley,R.G.
  TITLE     Isolation and characterization of the chicken homeodomain protein
            AKR
  JOURNAL   Nucleic Acids Res 23 (16), 3252-3259 (1995)
   PUBMED   7667102
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000043.1.
            
            On Sep 23, 2021 this sequence version replaced NM_205379.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: HAEL01004190.1, HAEL01010388.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-301               JAENSK010000043.1  3322171-3322471     c
            302-528             JAENSK010000043.1  3316390-3316616     c
            529-1610            JAENSK010000043.1  3313936-3315017     c
FEATURES             Location/Qualifiers
     source          1..1610
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
     gene            1..1610
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="TGFB induced factor homeobox 1"
                     /db_xref="CGNC:49758"
                     /db_xref="GeneID:396339"
     exon            1..301
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    157..159
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="upstream in-frame stop codon"
     CDS             286..1095
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="homeodomain protein AKR; TGFB-induced factor (TALE
                     family homeobox); avian knotted-related protein"
                     /codon_start=1
                     /product="homeobox protein AKR"
                     /protein_id="NP_990710.2"
                     /db_xref="CGNC:49758"
                     /db_xref="GeneID:396339"
                     /translation="

MKSKKGVVAISGSETEDDDTMDVPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKVLLSRQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGTKLPEGSMVESSMGTKNFLPLLEESPFLPASATLSKTVSSSKPVSPGSVLARPSVICHTTVTALKDAPFHFCQPGDVGQTTDLQQPPANAFTDSSLSYHEDASKLGPGANAQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLVA"

     misc_feature    286..408
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="propagated from UniProtKB/Swiss-Prot (Q90655.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(391..405,409..411,469..471,487..489,526..528,
                     532..537,544..549,553..561)
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(397..399,406..408,535..537,544..549,556..558)
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    445..561
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     misc_feature    922..993
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /note="propagated from UniProtKB/Swiss-Prot (Q90655.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            302..528
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /inference="alignment:Splign:2.1.0"
     exon            529..1610
                     /gene="TGIF1"
                     /gene_synonym="TGIF"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gggtgactctgcctcagtcactgcgggaagggggagggcggccgcgcgcaccttttcctcccgtgccttctcccactttcacgaggaaggaacaaaggcgaagcgagcccgcagccgccggaaagcccccaagggaggcggaatcccgctgctccctgacagcgacgcggccccgggccggccgtctggccgcgcttcttcgccgccctcctcctcgtcgccgagttgagaaggggagcagcgtcccgcctcgcctctcggagcgcggcggtcctcgccggcacgatgaaaagtaaaaaaggtgtagttgcaatatcaggcagtgaaacagaggatgatgacactatggatgtcccactagatctttcctcatctgctggctcgggcaaacggaggagacgtggcaacctacccaaagagtccgtgcagattcttcgggactggctgtatgagcaccgatacaatgcttatccttcagagcaagaaaaagtgctgttatcccggcaaacacacctctccacactacaggtctgcaactggtttatcaacgcacgccgcaggctcttacctgatatgctgaggaaggacggcaaagacccaaaccagttcaccatctcacggcgggggaccaagcttcctgaaggcagcatggtggagtcctccatgggcacaaagaacttccttcccttgctggaggagagccccttccttcccgcctctgccacgctcagcaagactgtgtcctcttccaagcctgtgtccccagggtctgtcctggctcggccctctgtgatttgccacacgactgtgactgcgttgaaagatgcccctttccatttttgtcagccaggtgatgtaggccagaccacagacctgcagcagcccccggccaacgccttcacagacagctccctctcctaccacgaggatgcctctaaactgggacctggtgcgaatgcgcaaagcgggctctttaacactcctcctccaaccccaccagacctcaaccaggattttagtggattccagctactggtggatgttgcactcaaaagggcggcagagatggagttgcaggcaaaactcgtggcctaaatccccttccttctctttccccattttgttttttatccaggcagggatctaacagctgtgtggttattgccacccacacgatatcaaaagacttaactgcattattattattttttttttattaatcttatttgcacaagggattgctgaaatgaagcttcctgtcactgagatggtcttcagtggaatatggtcattccaagaattataaactttaaagctactgtagaaaggattgtgtggtttttgtttttgttttttttttgttttgttttttttaatattttctttgtaggtttttcataatgtgagatggttcccaagatcatgtgatttgtttttttctatcagactgtgcaatatctagtaatgatatagagtcttcttatcattcccatgcggaacagaatataccgacacgctgtctaaaataaattttcaatttttttaacaatatgaactttggatgattatgctttttttcccacaatgtaataaaatattttctttaaaaa

//