2025-09-16 05:01:50, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_205252 1895 bp mRNA linear VRT 26-JUN-2025 DEFINITION Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA. ACCESSION NM_205252 VERSION NM_205252.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1895) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1895) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1895) AUTHORS Obinata,A. and Akimoto,Y. TITLE Involvement of Hex in the initiation of feather morphogenesis JOURNAL Int J Dev Biol 49 (8), 953-960 (2005) PUBMED 16281172 REMARK GeneRIF: Hex is upstream of Wnt7a and beta-catenin and regulates the Wnt signaling pathway in feather bud initiation REFERENCE 4 (bases 1 to 1895) AUTHORS Obinata,A. and Akimoto,Y. TITLE Expression of Hex during feather bud development JOURNAL Int J Dev Biol 49 (7), 885-890 (2005) PUBMED 16172986 REMARK GeneRIF: Hex plays an important role in the initiation of feather morphogenesis REFERENCE 5 (bases 1 to 1895) AUTHORS Crompton,M.R., Bartlett,T.J., MacGregor,A.D., Manfioletti,G., Buratti,E., Giancotti,V. and Goodwin,G.H. TITLE Identification of a novel vertebrate homeobox gene expressed in haematopoietic cells JOURNAL Nucleic Acids Res 20 (21), 5661-5667 (1992) PUBMED 1360645 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000232.1. On Sep 23, 2021 this sequence version replaced NM_205252.1. ##Evidence-Data-START## Transcript exon combination :: X64711.1, AJ452462.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-478 JAENSK010000232.1 735945-736422 c 479-657 JAENSK010000232.1 734531-734709 c 658-708 JAENSK010000232.1 734397-734447 c 709-1895 JAENSK010000232.1 732106-733292 c FEATURES Location/Qualifiers source 1..1895 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="6" /map="6" gene 1..1895 /gene="HHEX" /gene_synonym="PROBOX" /note="hematopoietically expressed homeobox" /db_xref="CGNC:66222" /db_xref="GeneID:396182" exon 1..478 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" CDS 97..930 /gene="HHEX" /gene_synonym="PROBOX" /note="homeobox protein HEX; homeobox protein PRH" /codon_start=1 /product="hematopoietically-expressed homeobox protein HHEX" /protein_id="NP_990583.2" /db_xref="CGNC:66222" /db_xref="GeneID:396182" /translation="
MQYQAPGAAPAAALGVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAAPAPHSLPAPPPPTLPSPNSSFTSLVAPYRTPVYEPTPIHPAFSHHLAATYGTGAYAGPLYSFPRAVGDYTHALIRQDPLGKPLLWSPFIQRPLHKRKGGQVRFSNEQTIELEKKFETQKYLSPPERKRLAKLLQLSERQVKTWFQNRRAKWRRLKQENPQATKKEEAEGTGDHGDPRPEGSPSPAGGGEAEPQDSPSAASQEDPESDVSDDSDQEVDIEGDKGFYSATR"
misc_feature 235..303 /gene="HHEX" /gene_synonym="PROBOX" /note="propagated from UniProtKB/Swiss-Prot (Q05502.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 523..699 /gene="HHEX" /gene_synonym="PROBOX" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 691..927 /gene="HHEX" /gene_synonym="PROBOX" /note="propagated from UniProtKB/Swiss-Prot (Q05502.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 479..657 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon 658..708 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" exon 709..1895 /gene="HHEX" /gene_synonym="PROBOX" /inference="alignment:Splign:2.1.0" ORIGIN
ggagaaacccgcggcggcggtggcagcagccggcggccgcgctcggggccgctctccgaggggcggccgggccgcggggggccggggagccgcgccatgcagtatcaggcgccgggcgcggctccggcggcggccctgggcgtcggcgtccctctgtacgcgcccacgccgctgctgcagcccgcgcaccccacgcccttctacatcgaggacatcctgggccgcggccccgccgccgcgccggccccccactccctgcccgccccgccgccgccgacgctgccgtcgcccaactcctccttcaccagcctggtggccccgtaccggacccccgtctacgagccgacccccatccacccggccttctctcaccacctcgccgccacctacggcaccggcgcttacgccgggcccctctactcctttccccgcgccgtcggcgactacacgcacgcactgatccgccaggaccccctgggaaagccgctgctgtggagccccttcatccagcggccgctgcataagaggaagggtgggcaggtgcgcttctccaacgagcagaccatcgagctggagaagaagttcgagacgcagaaatacctctccccgcccgagaggaagcgcctggccaagctgctgcagctcagcgagcgccaggtcaaaacgtggttccagaaccgcagagccaaatggaggcgactgaagcaggagaacccccaggccaccaaaaaggaggaggcggaaggcaccggcgatcacggcgaccctcggccggagggcagccccagccccgcgggggggggcgaggccgagccgcaggacagcccttcggccgcctcgcaggaggaccccgagtccgacgtctccgacgactccgaccaggaggtggacatcgagggcgacaaaggcttctacagcgccacacgctgacggcccgcgggcacggagccgagctcggcttgcgctgtcccgggactgcgggaaggaggattttatgacgggagaggaccttcaccattccgccgaaagacaaagaagcacgaacggactcgttctgtaataatctgagaaagaaaagatattcgttctgcaaacggtccgttttttttttggcagatctctgatttgattgtagggactgatcggtggtttgtatttactgtgtaagatctgtgtgtacgttgattggtgctctgaccgggacacagcgctgtgcccatctccggctgctggaacccccctcttccccagctcgtgtagtgggggagcactgagggcaggaccgtgcctttgtgtgtgcaaacgaatctgctttaaatggagtaatttaagtgtccttcgcaggcagagaagtgttttctgtgccatagagagggattggagcatcccgagagtgccttaccccacccaggacctgcagctgcatcccccggaaggatcccccctcaccgggcagaggctgtgggcacgttccgttttgctcttgatggagtgaaatgtccctcatcgcattttggaggattttgccccacaatctgtgtggttccatttgcagggaaaaaaaaacaaaaaccaaaaccaaacacagcaacaaaccaacccaggctatttttttccttgacaaatctgtcgtgctgtcccccagatttcccatttcagaaggaaatgaggggctgatagggcactgcgaggcgcagtgtggcagcgggcacccgtgcctggcgtgtccctctctgctcgtgtacatagcagtttgccttaaaagtctttgcggttttatacctcacattgttcatattttgtacatattggtttaaaagaaaaaaaaaaaggaatcaaaaactggtatttaatttctgatggatttcttcgaaataaaatgaaactctgcacca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]