LOCUS       NM_205164               1617 bp    mRNA    linear   VRT 08-APR-2024
DEFINITION  Gallus gallus NK2 homeobox 5 (NKX2-5), mRNA.
ACCESSION   NM_205164
VERSION     NM_205164.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1617)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1617)
  AUTHORS   Kelder,T.P., Vicente-Steijn,R., Harryvan,T.J., Kosmidis,G.,
            Gittenberger-de Groot,A.C., Poelmann,R.E., Schalij,M.J.,
            DeRuiter,M.C. and Jongbloed,M.R.
  TITLE     The sinus venosus myocardium contributes to the atrioventricular
            canal: potential role during atrioventricular node development?
  JOURNAL   J Cell Mol Med 19 (6), 1375-1389 (2015)
   PUBMED   25752780
  REMARK    GeneRIF: Data indicate that myocardial markers ISL1, TNNI2 and
            NKX2-5 and HCN4 were studied in sequential stages of chick embryo
            development.
REFERENCE   3  (bases 1 to 1617)
  AUTHORS   Bai,C., Hou,L., Zhang,M., Wang,L., Guan,W. and Ma,Y.
  TITLE     Identification and biological characterization of chicken embryonic
            cardiac progenitor cells
  JOURNAL   Cell Prolif 46 (2), 232-242 (2013)
   PUBMED   23510478
REFERENCE   4  (bases 1 to 1617)
  AUTHORS   Clark,C.D., Zhang,B., Lee,B., Evans,S.I., Lassar,A.B. and Lee,K.H.
  TITLE     Evolutionary conservation of Nkx2.5 autoregulation in the second
            heart field
  JOURNAL   Dev Biol 374 (1), 198-209 (2013)
   PUBMED   23165293
  REMARK    GeneRIF: Nkx2.5 autoregulation is evolutionarily conserved in the
            second heart field
REFERENCE   5  (bases 1 to 1617)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1617)
  AUTHORS   Harris,B.S., Spruill,L., Edmonson,A.M., Rackley,M.S., Benson,D.W.,
            O'Brien,T.X. and Gourdie,R.G.
  TITLE     Differentiation of cardiac Purkinje fibers requires precise
            spatiotemporal regulation of Nkx2-5 expression
  JOURNAL   Dev Dyn 235 (1), 38-49 (2006)
   PUBMED   16245335
  REMARK    GeneRIF: Overexpression of Nkx2-5 causes inhibition of slow tonic
            myosin heavy chain protein, a late Purkinje fiber marker, but does
            not affect Cx40 levels
REFERENCE   7  (bases 1 to 1617)
  AUTHORS   Lee,K.H., Evans,S., Ruan,T.Y. and Lassar,A.B.
  TITLE     SMAD-mediated modulation of YY1 activity regulates the BMP response
            and cardiac-specific expression of a GATA4/5/6-dependent chick
            Nkx2.5 enhancer
  JOURNAL   Development 131 (19), 4709-4723 (2004)
   PUBMED   15329343
  REMARK    GeneRIF: characterized the cis-regulatory elements of the tinman
            homolog Nkx2.5
REFERENCE   8  (bases 1 to 1617)
  AUTHORS   Buchberger,A., Pabst,O., Brand,T., Seidl,K. and Arnold,H.H.
  TITLE     Chick NKx-2.3 represents a novel family member of vertebrate
            homologues to the Drosophila homeobox gene tinman: differential
            expression of cNKx-2.3 and cNKx-2.5 during heart and gut
            development
  JOURNAL   Mech Dev 56 (1-2), 151-163 (1996)
   PUBMED   8798155
REFERENCE   9  (bases 1 to 1617)
  AUTHORS   Schultheiss,T.M., Xydas,S. and Lassar,A.B.
  TITLE     Induction of avian cardiac myogenesis by anterior endoderm
  JOURNAL   Development 121 (12), 4203-4214 (1995)
   PUBMED   8575320
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000256.1.
            
            On Sep 23, 2021 this sequence version replaced NM_205164.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X91838.1, SRR13267653.17320.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992323, SAMEA103992484
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-442               JAENSK010000256.1  7415275-7415716     c
            443-1617            JAENSK010000256.1  7413422-7414596     c
FEATURES             Location/Qualifiers
     source          1..1617
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="13"
                     /map="13"
     gene            1..1617
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="NK2 homeobox 5"
                     /db_xref="CGNC:2083"
                     /db_xref="GeneID:396073"
     exon            1..442
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    127..129
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="upstream in-frame stop codon"
     CDS             166..1050
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="homeobox protein NK-2 homolog E; NK2 transcription
                     factor related, locus 5"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.5"
                     /protein_id="NP_990495.1"
                     /db_xref="CGNC:2083"
                     /db_xref="GeneID:396073"
                     /translation="

MFPSPVTTTPFSVKDILNLEQQQQGGLAPMELSSPSCMLATFKQEAFGSEPPALPELPEPPPAKPPAAFPGPYYVKSYGEMDTAKDSKADKKELCALHKSLEQEKRELEDPERPRQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVLKLTSTQVKIWFQNRRYKCKRQRQDQTLEMVGIPPPRRIAVPVLVRDGKPCLGESSPYSSPYNVSINPYSYNAYPAYPNYNSPACNANYNCSYPAVQPVQPSAAGNNFMNFSVGDLNSVQPPIPQGNAGISTLHGIRAW"

     misc_feature    307..372
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="propagated from UniProtKB/Swiss-Prot (Q90788.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    469..531
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="propagated from UniProtKB/Swiss-Prot (Q90788.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    541..693
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    <544..852
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /note="Homeodomain-containing transcription factor
                     [Transcription]; Region: COG5576"
                     /db_xref="CDD:227863"
     exon            443..1617
                     /gene="NKX2-5"
                     /gene_synonym="CNKX-2.5; NKX-2.5; NKX2E"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cccttatggtccgctcctacctgcgcgcagcgcacagggccgcctccctcgggatgctatgtgccccccccggcagcccacgctgcagcagcgctccgggccgcccgctcctcgcctccccttccatgaccccgggctgcggccgctgccccgctctcctccgcaatgtttcctagccctgtgacgacgactcccttctcggtcaaggatattttgaacctggagcagcagcagcagggcggtctggcccccatggagctctcttcgccctcctgcatgttggccaccttcaagcaggaggcgttcggctccgagccgcccgccctgcccgagctccccgagccgcccccggccaagccgcccgccgccttccccggcccctactacgtgaagagctacggggagatggacacggccaaggattccaaggcggacaagaaagaactgtgtgccctgcacaagagtctggagcaggagaagagagagctggaggatcccgagcggcccagacagaggaagaggaggaaaccccgcgtcctcttttctcaagcccaagtctacgaactggagagaaggttcaagcagcagaaatacctctcagctcccgagagagaccatctagcgaacgtcctaaagctcacctctacccaggtgaaaatttggttccagaacagaaggtacaaatgcaaaaggcagagacaggaccagaccctggagatggtggggatcccacccccccggcggatagcggtgccggtgctggtgcgggacgggaagccctgcctgggggagtcttctccctacagctcgccctacaatgtcagcattaacccctatagctacaacgcctaccccgcgtaccctaactacaacagccctgcctgcaacgccaactacaactgcagctacccggccgtgcagcccgtgcagccctcggcggcaggcaacaacttcatgaacttcagcgtgggggacttgaattcggtgcagccgcccatcccgcaggggaacgcgggcatctccacgttgcacgggatccgagcgtggtagggcggcccgggcccggagctgcgcgaggggtcgggacatcgccgggctgcggggcgagggcggctcggtgcgggaccgcggggagctccccggggctctggggcacggtgttcgacccgctcattcccctctccccaccttcctacaaaacagtcggtcatttcgcttgacttgttcctaaacaacggcaagccaagccctacaactcattattattattatttcttctttttctttctttcttttttttttttaaactcttatcctaattattattgagaaccacatttaattttgcacttcccgtccggttcctcccccccctttccctcccggtcgccgctccccgcggtcgctgtcccccagcgcaggacggggacggccccaccgagctccgggagctccgatccgccccccccccgctccccgtagggttatgcactaaaacgtgagttaggattcagatgcactgcccgctcctcgccccgccacccgttcggacgtgtttccctttgctgtacgagctgacggagatcagcgagttgtcattaaagagagtggcttcac

//