2024-07-03 22:32:55, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_205137 1111 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA. ACCESSION NM_205137 XM_444649 VERSION NM_205137.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1111) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1111) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1111) AUTHORS Tanaka M, Kasahara H, Bartunkova S, Schinke M, Komuro I, Inagaki H, Lee Y, Lyons GE and Izumo S. TITLE Vertebrate homologs of tinman and bagpipe: roles of the homeobox genes in cardiovascular development JOURNAL Dev Genet 22 (3), 239-249 (1998) PUBMED 9621431 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from Y10655.1. On Aug 30, 2004 this sequence version replaced XM_444649.1. ##Evidence-Data-START## Transcript exon combination :: Y10655.1, SRR13267650.32988.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992527, SAMEA2812691 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1111 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="22" /map="22" gene 1..1111 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="NK2 homeobox 6" /db_xref="CGNC:49622" /db_xref="GeneID:396037" exon 1..143 /gene="NKX2-6" /gene_synonym="NKX2.8" /inference="alignment:Splign:2.1.0" CDS 32..613 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="homeobox protein Nkx-2.8; NK2 transcription factor related, locus 6" /codon_start=1 /product="homeobox protein Nkx-2.6" /protein_id="NP_990468.1" /db_xref="CGNC:49622" /db_xref="GeneID:396037" /translation="
MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP"
misc_feature 224..394 /gene="NKX2-6" /gene_synonym="NKX2.8" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 144..1042 /gene="NKX2-6" /gene_synonym="NKX2.8" /inference="alignment:Splign:2.1.0" ORIGIN
cagggagctcacaccgatccccccccggaggatgctgcccacccctttctccgtcgaggatatcctcagcctggagcagagcagcgctcccggagcccccggggtccgccgcagcccttccgtggaggaggaaccgccgtcgggacaatgtctgctctcccagcccttgcaggcagaccagcagcaaactgacccctgccaccaccccaagcaaccgcagcggcgcaaaccccgcgttttgttctcccaaactcaggtgttggagttggagcggcgattcaagcagcagaaatacctctctgcactggaaagggaacacctggccaacgtgctccagctcacctccacccaggtgaaaatctggttccagaaccggcgctacaaatgcaagaggcagaggcaggatagatccctggagatggccacctacccactgccaccacgtaaagtggctgttccggtgctggtcagaaatggcaagccttgctttgaggggtcccaaccccacctggctccttatgggatcaccgtcagcccctactcctatagcacctactacagtgcctacggggtgagctatggggtgggatatactggggtgctcacaccatgagcttgggctcagcaccagttgagatgtggcccaggaaagggatgggggcatccggagtcgtaatggacagcaggtggtgcgtccaacctcaccaaccagcccaaggaaagggacttctggtgctgcggatttggggacctcagtgcaggggcatttatttatttgggcacaaacatggagtccatcccatctcaccccatagggatggtcctgtgggatgcatagggatgggatgctgctcttcttcctaaggaaacagggtctgtgcacaccactgcgcctttgcttttccatgaacactctatttaaggctttgagttcctctcatcttttgggatattcatatttcttaatgacttaaaagcacaggtgttcgtttctgtcttggttattgttattatttgcaattaaaaaaaaataaggtgggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]