GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-12 20:01:31, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_205076               1112 bp    mRNA    linear   VRT 27-APR-2025
DEFINITION  Gallus gallus neuronal differentiation 4 (NEUROD4), mRNA.
ACCESSION   NM_205076
VERSION     NM_205076.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1112)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1112)
  AUTHORS   Strony,R., Gerhart,J., Tornambe,D., Perlman,J., Neely,C., Dare,J.,
            Stewart,B. and George-Weinstein,M.
  TITLE     NeuroM and MyoD are expressed in separate subpopulations of cells
            in the pregastrulating epiblast
  JOURNAL   Gene Expr Patterns 5 (3), 387-395 (2005)
   PUBMED   15661645
  REMARK    GeneRIF: NeuroM and MyoD are present in separate subpopulations of
            cells in the pregastrulating epiblast; epiblast cells with NeuroM
            are more dependent on exogenous factors to differentiate than those
            with MyoD
REFERENCE   3  (bases 1 to 1112)
  AUTHORS   Roztocil,T., Matter-Sadzinski,L., Alliod,C., Ballivet,M. and
            Matter,J.M.
  TITLE     NeuroM, a neural helix-loop-helix transcription factor, defines a
            new transition stage in neurogenesis
  JOURNAL   Development 124 (17), 3263-3272 (1997)
   PUBMED   9310321
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from Y09597.1.
            
            ##Evidence-Data-START##
            Transcript is intronless :: Y09597.1 [ECO:0000345]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1112
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="34"
                     /map="34"
                     /breed="Leghorn"
     gene            1..1112
                     /gene="NEUROD4"
                     /note="neuronal differentiation 4"
                     /db_xref="CGNC:49575"
                     /db_xref="GeneID:395959"
     exon            1..1112
                     /gene="NEUROD4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    105..107
                     /gene="NEUROD4"
                     /note="upstream in-frame stop codon"
     CDS             111..1103
                     /gene="NEUROD4"
                     /function="neuronal helix-loop-helix transcription factor"
                     /note="NeuroM protein; neurogenic differentiation 4"
                     /codon_start=1
                     /product="neurogenic differentiation factor 4"
                     /protein_id="NP_990407.1"
                     /db_xref="CGNC:49575"
                     /db_xref="GeneID:395959"
                     /translation="
MTKTYTKAKEMAELVGTQGWMDDALSSKDELKAENGRPGPFGLVAGLNEEHDSIEEEEEEEDDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKSFVEMLCKGLSQPTSNLVAGCLQLGPQTLFLEKHEEKTPGCESAISSHSFTYQSPGLPSPPYGSMETHLLHLKPPAFKSLVDASFGNPPDCTTPPYEGPLTPPLSISGNFSLKQDGSPDLDKPYAFMAHYPSVSLAGAHGHPTHFQNAVPRYEIPIDMSYESYPHHVAGPQLNAIFNE"
     misc_feature    111..347
                     /gene="NEUROD4"
                     /note="propagated from UniProtKB/Swiss-Prot (P79766.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    285..545
                     /gene="NEUROD4"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     neurogenic differentiation factor 4 (NeuroD4) and similar
                     proteins; Region: bHLH_TS_NeuroD4_ATOH3; cd19721"
                     /db_xref="CDD:381564"
     misc_feature    327..347
                     /gene="NEUROD4"
                     /note="propagated from UniProtKB/Swiss-Prot (P79766.1);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000255"
     misc_feature    order(387..389,396..401,405..407,411..413,420..422,
                     480..485)
                     /gene="NEUROD4"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381564"
     misc_feature    order(417..419,426..431,435..440,447..452,483..488,
                     495..497,507..509,513..518,525..530,534..539)
                     /gene="NEUROD4"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381564"
     misc_feature    546..899
                     /gene="NEUROD4"
                     /note="Neuronal helix-loop-helix transcription factor;
                     Region: Neuro_bHLH; pfam12533"
                     /db_xref="CDD:463621"
     misc_feature    594..659
                     /gene="NEUROD4"
                     /note="propagated from UniProtKB/Swiss-Prot (P79766.1);
                     Region: Leucine-zipper"
ORIGIN      
acaggaagcagtcggtgcctctggggggatggctttagttccttatggactcggtgctcctgctggctttgcttaacatctcccgtcccccctcgttacagagctgagagatgacgaagacgtacaccaaagccaaggagatggcagagctggtgggcacccagggctggatggacgacgcgctgagctccaaggatgagctgaaggcagagaacggcaggccaggacctttcgggttggtggcgggcttgaacgaagagcacgacagcatcgaggaggaagaggaggaagaggatgatggggagaagccgaagagaagagggccgaagaagaagaagatgaccaaggccaggttggagaggttcagggctcggcgggtgaaagccaacgctcgggagcgcacgcggatgcacggactgaacgatgccctggacaacctgaggagggtgatgccctgctactccaaaacacagaagctgtccaagatcgagacgttgaggttggcgaggaattacatctgggctctgtccgaggtgctcgaaacggggcagaccccggaagggaagagcttcgtggagatgctctgcaaagggttatcccagcccaccagcaacctggtggccggctgcctgcagctggggccgcagaccttattcctggagaagcacgaggagaaaaccccgggctgcgagtcggccatttccagccactccttcacctaccagtccccggggctgcccagcccgccctacggctccatggaaacccacctgctgcacctcaagccccccgccttcaagagtttggtggatgcttcttttgggaacccccccgactgcaccactcccccatacgagggtcccctcacgccgcccctgagcatcagtgggaacttctctttgaagcaggatggctctccagacctggataagccctacgccttcatggctcactacccttcggtcagcctggccggggcacatggacatcccacccacttccaaaacgcagtgccccgttatgagatccccatagacatgagctacgagtcctaccctcaccacgtggccgggcctcagctcaacgccatcttcaacgagtagcgaagcggg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]