2025-07-01 07:52:50, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_205076 1112 bp mRNA linear VRT 03-APR-2024 DEFINITION Gallus gallus neuronal differentiation 4 (NEUROD4), mRNA. ACCESSION NM_205076 VERSION NM_205076.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1112) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1112) AUTHORS Strony,R., Gerhart,J., Tornambe,D., Perlman,J., Neely,C., Dare,J., Stewart,B. and George-Weinstein,M. TITLE NeuroM and MyoD are expressed in separate subpopulations of cells in the pregastrulating epiblast JOURNAL Gene Expr Patterns 5 (3), 387-395 (2005) PUBMED 15661645 REMARK GeneRIF: NeuroM and MyoD are present in separate subpopulations of cells in the pregastrulating epiblast; epiblast cells with NeuroM are more dependent on exogenous factors to differentiate than those with MyoD REFERENCE 3 (bases 1 to 1112) AUTHORS Roztocil,T., Matter-Sadzinski,L., Alliod,C., Ballivet,M. and Matter,J.M. TITLE NeuroM, a neural helix-loop-helix transcription factor, defines a new transition stage in neurogenesis JOURNAL Development 124 (17), 3263-3272 (1997) PUBMED 9310321 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from Y09597.1. ##Evidence-Data-START## Transcript is intronless :: Y09597.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1112 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="34" /map="34" /breed="Leghorn" gene 1..1112 /gene="NEUROD4" /note="neuronal differentiation 4" /db_xref="CGNC:49575" /db_xref="GeneID:395959" exon 1..1112 /gene="NEUROD4" /inference="alignment:Splign:2.1.0" misc_feature 105..107 /gene="NEUROD4" /note="upstream in-frame stop codon" CDS 111..1103 /gene="NEUROD4" /function="neuronal helix-loop-helix transcription factor" /note="NeuroM protein; neurogenic differentiation 4" /codon_start=1 /product="neurogenic differentiation factor 4" /protein_id="NP_990407.1" /db_xref="CGNC:49575" /db_xref="GeneID:395959" /translation="
MTKTYTKAKEMAELVGTQGWMDDALSSKDELKAENGRPGPFGLVAGLNEEHDSIEEEEEEEDDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKSFVEMLCKGLSQPTSNLVAGCLQLGPQTLFLEKHEEKTPGCESAISSHSFTYQSPGLPSPPYGSMETHLLHLKPPAFKSLVDASFGNPPDCTTPPYEGPLTPPLSISGNFSLKQDGSPDLDKPYAFMAHYPSVSLAGAHGHPTHFQNAVPRYEIPIDMSYESYPHHVAGPQLNAIFNE"
misc_feature 111..347 /gene="NEUROD4" /note="propagated from UniProtKB/Swiss-Prot (P79766.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 285..545 /gene="NEUROD4" /note="basic helix-loop-helix (bHLH) domain found in neurogenic differentiation factor 4 (NeuroD4) and similar proteins; Region: bHLH_TS_NeuroD4_ATOH3; cd19721" /db_xref="CDD:381564" misc_feature 327..347 /gene="NEUROD4" /note="propagated from UniProtKB/Swiss-Prot (P79766.1); Region: Nuclear localization signal. /evidence=ECO:0000255" misc_feature order(387..389,396..401,405..407,411..413,420..422, 480..485) /gene="NEUROD4" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:381564" misc_feature order(417..419,426..431,435..440,447..452,483..488, 495..497,507..509,513..518,525..530,534..539) /gene="NEUROD4" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:381564" misc_feature 546..899 /gene="NEUROD4" /note="Neuronal helix-loop-helix transcription factor; Region: Neuro_bHLH; pfam12533" /db_xref="CDD:463621" misc_feature 594..659 /gene="NEUROD4" /note="propagated from UniProtKB/Swiss-Prot (P79766.1); Region: Leucine-zipper" ORIGIN
acaggaagcagtcggtgcctctggggggatggctttagttccttatggactcggtgctcctgctggctttgcttaacatctcccgtcccccctcgttacagagctgagagatgacgaagacgtacaccaaagccaaggagatggcagagctggtgggcacccagggctggatggacgacgcgctgagctccaaggatgagctgaaggcagagaacggcaggccaggacctttcgggttggtggcgggcttgaacgaagagcacgacagcatcgaggaggaagaggaggaagaggatgatggggagaagccgaagagaagagggccgaagaagaagaagatgaccaaggccaggttggagaggttcagggctcggcgggtgaaagccaacgctcgggagcgcacgcggatgcacggactgaacgatgccctggacaacctgaggagggtgatgccctgctactccaaaacacagaagctgtccaagatcgagacgttgaggttggcgaggaattacatctgggctctgtccgaggtgctcgaaacggggcagaccccggaagggaagagcttcgtggagatgctctgcaaagggttatcccagcccaccagcaacctggtggccggctgcctgcagctggggccgcagaccttattcctggagaagcacgaggagaaaaccccgggctgcgagtcggccatttccagccactccttcacctaccagtccccggggctgcccagcccgccctacggctccatggaaacccacctgctgcacctcaagccccccgccttcaagagtttggtggatgcttcttttgggaacccccccgactgcaccactcccccatacgagggtcccctcacgccgcccctgagcatcagtgggaacttctctttgaagcaggatggctctccagacctggataagccctacgccttcatggctcactacccttcggtcagcctggccggggcacatggacatcccacccacttccaaaacgcagtgccccgttatgagatccccatagacatgagctacgagtcctaccctcaccacgtggccgggcctcagctcaacgccatcttcaacgagtagcgaagcggg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]