2025-07-11 14:45:39, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_204676 2415 bp mRNA linear VRT 12-JUN-2024 DEFINITION Gallus gallus caudal type homeobox 1 (CDX1), mRNA. ACCESSION NM_204676 VERSION NM_204676.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 2415) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 2415) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 2415) AUTHORS Gaunt,S.J., Drage,D. and Cockley,A. TITLE Vertebrate caudal gene expression gradients investigated by use of chick cdx-A/lacZ and mouse cdx-1/lacZ reporters in transgenic mouse embryos: evidence for an intron enhancer JOURNAL Mech Dev 120 (5), 573-586 (2003) PUBMED 12782274 REFERENCE 4 (bases 1 to 2415) AUTHORS Doll,U. and Niessing,J. TITLE Continued expression of the chicken caudal homologue in endodermally derived organs JOURNAL Dev Biol 156 (1), 155-163 (1993) PUBMED 7680627 REFERENCE 5 (bases 1 to 2415) AUTHORS Frumkin,A., Rangini,Z., Ben-Yehuda,A., Gruenbaum,Y. and Fainsod,A. TITLE A chicken caudal homologue, CHox-cad, is expressed in the epiblast with posterior localization and in the early endodermal lineage JOURNAL Development 112 (1), 207-219 (1991) PUBMED 1685114 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000256.1. On Sep 23, 2021 this sequence version replaced NM_204676.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: AB046532.1, SRR12888524.311001.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-572 JAENSK010000256.1 11442638-11443209 c 573-718 JAENSK010000256.1 11434726-11434871 c 719-2415 JAENSK010000256.1 11432898-11434594 c FEATURES Location/Qualifiers source 1..2415 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="13" /map="13" gene 1..2415 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="caudal type homeobox 1" /db_xref="CGNC:4232" /db_xref="GeneID:395397" exon 1..572 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /inference="alignment:Splign:2.1.0" misc_feature 119..121 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="upstream in-frame stop codon" CDS 143..925 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="homeobox protein CHOX-CAD; caudal-type homeodomain protein A; caudal type homeo box transcription factor 1; caudal type homeobox transcription factor 1; caudal-type homeodomain protein, CdxA" /codon_start=1 /product="homeobox protein CDX-1" /protein_id="NP_990007.2" /db_xref="CGNC:4232" /db_xref="GeneID:395397" /translation="
MYVGYLLDKDTNMYPSPVRHPSLNLNPQNYVPGPPQYSDFASYHHVPGINNDPHHGQPAAAWGSPYTPAKEDWHSYGTAAASAATNPGQFGFSPPDFNPMQPHAGSGLLPPAISSSVPQLSPNAQRRTPYEWMRRSIPSTSSSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAAALGLTERQVKIWFQNRRAKERKVNKKKLQQQSQPTSTTTPTPPAVGTPGPMGTLCSGSAPSLVSSSPLTIKEEFMP"
misc_feature 179..571 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="Caudal like protein activation region; Region: Caudal_act; pfam04731" /db_xref="CDD:461413" misc_feature 593..760 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 596..661 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="propagated from UniProtKB/Swiss-Prot (Q9DEB6.2); Region: Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902" misc_feature 713..748 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="propagated from UniProtKB/Swiss-Prot (Q9DEB6.2); Region: Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902" misc_feature 752..922 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /note="propagated from UniProtKB/Swiss-Prot (Q9DEB6.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 573..718 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /inference="alignment:Splign:2.1.0" exon 719..2415 /gene="CDX1" /gene_synonym="CDX-A; CDXA; CHox-cad; CHOX-CAD1" /inference="alignment:Splign:2.1.0" ORIGIN
ggccccgggacacagctccccaaggcgcccaggtgagcgcggtgaaggaggggcggccgctgcgtgacacccggccgcttcggcacggagcggcgcagcgcggtgcatcggcacagcatgagcacagagccaggtggagaagatgtatgtaggctatcttttggataaggacaccaacatgtatcccagtcccgtccggcatcccagcctcaacctcaacccccagaactacgtgccggggccaccccagtactcggacttcgccagctaccaccatgtgccagggattaacaacgacccgcaccatgggcagcccgcagctgcctggggctcaccctacacccctgccaaggaggactggcactcatacggcaccgctgccgcctccgccgccaccaacccggggcagtttggatttagccccccggattttaaccccatgcagccccatgcgggctctggactcctgcctccagccatcagcagctcggtgccacagctgtcccctaatgcacagaggcgcaccccgtacgaatggatgaggcgcagtattcccagcaccagcagcagcggcaagacgaggacaaaggacaagtaccgggtggtgtacacggaccaccaacgcctggagctggagaaggaatttcactacagccgctacatcaccatccgccgtaaggccgagctggctgctgccctggggctcactgaacggcaggtgaaaatctggtttcagaaccggagggcgaaagagaggaaggtgaataaaaagaagctgcagcagcagagccagcccaccagcaccaccacgccaacccccccagccgtgggcacgccagggcccatggggaccctctgcagtggcagtgccccaagccttgtctcctcatctccgctcaccatcaaggaggagttcatgccttagccccctccaccagccatagacactgagagataagcactacacggcagagcttgttgctgagcgcccaaagacaccacgtcctctggggcatggtggctctgttgccttcccaagaggctgatgagctctgtcctacacaaagcccatacgttaggtagtgctgttctcctgtaggaaacgtgcgctggtctccggtattggtagcccaaaaccagtgggatgagtctttaagtggtgctggaggaccctttctgtggcacatcagaatgagccggtgggatgcttcctgcacggtcttcctggtgatccagctgcctgctgctttggagcagctttagtgaggctgaactaggggaaagtcttggctggactcgaggcagaataaatctcagctgagattgtctgcaggatctgccacacctggagcgagttggacaacaggagctgggtaggaccctcagcagtggggctggagggggaaagggggctccttaaactgagacaatgacagtgagtgtcccccatgtcccccagccaccatccccagctccatccctgcagcaactcagggccatcgcgagacctgcagacatctgtcccacagatggaccaccctgcggaggttttgagaccaccttccagcatggaggaacaagaacaaggtttgcagttaggacactggacagctctaggttgcccagaggggccgctcacctacccatggcactgcagaacctgcacagctccgtgctgcaccaaggcactgccagctgccgggaccatcatggtgatgggacatgtcctggcacaagatgatggatagctggcttccatagagagggatgggtggatttgtgctgttttctctgaaacacaaaaggctctgggttttgcccactttgtactcctccatgtgctgcaccattggtaaccaatggcttttttttcctgctggaaatccacagttaaaattccccttaatcctgctgactcctgggatctctactggcccagctaccttacagcccagttttggatgccccaaagggcgtgctgggacacaggagggtttgaggctcctgcttgggtctgtggcttcccaagaccaaggtgagggtgcagaggctctgatggttctctcctagcaccatcatgctgagccccagcaggaacaagaagtggaggtgtccctgttgcctgcagagcccctcacccattcccagcccattctggcccagaactcacagtgttaggggtttaatactgggatttaagctccttgacacccactgcacctacagccccttaatagggtctgcatcccccaccatggggaccagtgacacctccctggggccaccactgctactttgcagcaaaggcagacaccggtgttggcttgggacttcagctcagggcttgtgtacagaaggcagaacgttttattttctaggctttggtcaaaataaaagtgagcaggagccctgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]