2025-07-07 06:17:30, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_204674 2256 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus fibroblast growth factor 19 (FGF19), mRNA. ACCESSION NM_204674 VERSION NM_204674.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 2256) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 2256) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 2256) AUTHORS Okamoto M, Bito T, Noji S and Ohuchi H. TITLE Subtype-specific expression of Fgf19 during horizontal cell development of the chicken retina JOURNAL Gene Expr Patterns 9 (5), 306-313 (2009) PUBMED 19272464 REMARK GeneRIF: Results suggest that Fgf19 is expressed by the early migratory horizontal precursors, and later by the presumptive axon-bearing HCs. REFERENCE 4 (bases 1 to 2256) AUTHORS Okamoto M, Tomonari S, Naito Y, Saigo K, Noji S, Ui-Tei K and Ohuchi H. TITLE Introduction of silencing-inducing transgene against Fgf19 does not affect expression of Tbx5 and beta3-tubulin in the developing chicken retina JOURNAL Dev Growth Differ 50 (3), 159-168 (2008) PUBMED 18312426 REMARK GeneRIF: Fgf19 is not required for expression of dorso-ventral morphogenetic genes in the eye REFERENCE 5 (bases 1 to 2256) AUTHORS Gimeno L and Martinez S. TITLE Expression of chick Fgf19 and mouse Fgf15 orthologs is regulated in the developing brain by Fgf8 and Shh JOURNAL Dev Dyn 236 (8), 2285-2297 (2007) PUBMED 17654705 REMARK GeneRIF: Fgf19 presents an expression in the isthmic alar plate, diencephalic and mesencephalic parabasal plates, hindbrain basal plate, as well as in the zona limitans intrathalamica (zli). REFERENCE 6 (bases 1 to 2256) AUTHORS Sanchez-Calderon H, Francisco-Morcillo J, Martin-Partido G and Hidalgo-Sanchez M. TITLE Fgf19 expression patterns in the developing chick inner ear JOURNAL Gene Expr Patterns 7 (1-2), 30-38 (2007) PUBMED 16798106 REMARK GeneRIF: detailed spatial and temporal patterns of Fgf19 expression in the developing inner ear from otic cup (stage 14) to 8 embryonic days (stage 34) REFERENCE 7 (bases 1 to 2256) AUTHORS Francisco-Morcillo J, Sanchez-Calderon H, Kawakami Y, Izpisua Belmonte JC, Hidalgo-Sanchez M and Martin-Partido G. TITLE Expression of Fgf19 in the developing chick eye JOURNAL Brain Res Dev Brain Res 156 (1), 104-109 (2005) PUBMED 15862633 REMARK GeneRIF: Fgf19 was expressed in a transient manner in postmitotic neuroblasts during the migration from the ventricular surface to their final location. and in retina not detected at p30. REFERENCE 8 (bases 1 to 2256) AUTHORS Kurose H, Bito T, Adachi T, Shimizu M, Noji S and Ohuchi H. TITLE Expression of Fibroblast growth factor 19 (Fgf19) during chicken embryogenesis and eye development, compared with Fgf15 expression in the mouse JOURNAL Gene Expr Patterns 4 (6), 687-693 (2004) PUBMED 15465490 REMARK GeneRIF: Fgf19 is expressed in the developing chicken retina REFERENCE 9 (bases 1 to 2256) AUTHORS Ladher RK, Anakwe KU, Gurney AL, Schoenwolf GC and Francis-West PH. TITLE Identification of synergistic signals initiating inner ear development JOURNAL Science 290 (5498), 1965-1967 (2000) PUBMED 11110663 REMARK GeneRIF: Induces the inner ear COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000214.1. On Nov 8, 2021 this sequence version replaced NM_204674.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: AF315355.1, BU122912.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN03376184 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-358 JAENSK010000214.1 11146909-11147266 c 359-462 JAENSK010000214.1 11146701-11146804 c 463-2256 JAENSK010000214.1 11142347-11144140 c FEATURES Location/Qualifiers source 1..2256 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="5" /map="5" gene 1..2256 /gene="FGF19" /gene_synonym="FGF-19" /note="fibroblast growth factor 19" /db_xref="CGNC:66203" /db_xref="GeneID:395394" exon 1..358 /gene="FGF19" /gene_synonym="FGF-19" /inference="alignment:Splign:2.1.0" CDS 121..795 /gene="FGF19" /gene_synonym="FGF-19" /codon_start=1 /product="fibroblast growth factor 19 precursor" /protein_id="NP_990005.2" /db_xref="CGNC:66203" /db_xref="GeneID:395394" /translation="
MGPRPAAPGAALALLGIAAAAAAARSLPLPDAGPHVNYGWGEPIRLRHLYTASKHGLFSCFLRIGGDGRVDAVGSQSPQSLLEIRAVAVRTVAIKGVQSSRYLCMDEAGRLHGQLSYSIEDCSFEEEIRPDGYNVYKSKKYGISVSLSSAKQRQQFKGKDFLPLSHFLPMINTVPVEVTDFGEYGDYSQAFEPEVYSSPLETDSMDPFGITSKLSPVKSPSFQK"
sig_peptide 121..189 /gene="FGF19" /gene_synonym="FGF-19" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 250..633 /gene="FGF19" /gene_synonym="FGF-19" /note="FGF domain, beta-trefoil fold, found in fibroblast growth factor 19 (FGF19) and similar proteins; Region: beta-trefoil_FGF19; cd23331" /db_xref="CDD:467017" misc_feature order(250..261,367..369,502..504,622..633) /gene="FGF19" /gene_synonym="FGF-19" /note="trimer interface [polypeptide binding]; other site" /db_xref="CDD:467017" exon 359..462 /gene="FGF19" /gene_synonym="FGF-19" /inference="alignment:Splign:2.1.0" exon 463..2256 /gene="FGF19" /gene_synonym="FGF-19" /inference="alignment:Splign:2.1.0" ORIGIN
acaccgccagccgcacagagcgcccaaccccgtatcgcaccgcaccgccccgcaccgcccgcggcaacgccgccgcccgacccgagcccgagcccgagtctgagtccgaggccgccgcggatggggccgcgccccgctgcacccggcgctgccctggcgctgctggggatcgccgccgccgccgccgccgccaggtccctgccgctgcccgacgcgggtccgcacgtcaactacggctggggggaacccatccggctgcggcacctctacaccgccagcaagcacgggctcttcagctgcttcctgcgcattggcggcgacggccgggtggacgctgtcggtagccagagcccgcagagtctgttggagatccgcgccgtggcggtgcgcaccgtggccatcaagggcgtgcagagctcccgctacctctgcatggacgaggcggggcggctgcacgggcagctcagctattccattgaggactgttcctttgaagaggagattcgtccagacggctacaacgtgtataaatcaaagaaatacgggatatcggtgtctttgagcagtgccaaacaaagacagcaattcaaaggaaaagattttctcccgctgtctcacttcttacccatgatcaacactgtgccagtggaggtgacagactttggtgaatatggtgattacagccaggcttttgagccagaggtctactcatcgcctctcgaaacggacagcatggatccctttgggatcacttccaaactgtctccagtgaagagccccagctttcagaaatgactctgattgcacacgcggttttaaagagataccgcagaatgttgcaggtttttagcttcttgtgtagtgatgtctcaaacgtttttttcacgtctcagtatggagacggcatttcccgtacaatgtgttgtacctataagagctgagtgcccagttgccatattcgaaagaattgcctctccgtagtatacttggaaaagaaaaattaaataagagcagcttaacaaattcatcagagttcctccattactgtggtgatgataaaatacatagctttcgtacatcaaattcattaccacatatgttcacctgttgtttctgttcatatatataaatacaggaaatcttgccatccacagggaagttcacaaccttgtagacaaacatttggaacaaaacacagttaaggaagactgagcaagtgtggttatgtgaactaaagttagcgctgtttcttgaaaagctgctgacaaccttctgggaaggctttctgttgaaagcataccactgaaaaacaattctgctgatatattgtgctttttcttcccttaggaaagaggggaagagaggaaaatatttcttccttccccaactgctaagggataccttggaaaactggattttattttataggctaatttatgttcactacgggatcttcatcgtccagcatagacttgtctttaatgctaatgggaattcagcatgtgggtaggagtgtatacagaactagcatttgtgttcatctggtaggaatgagcagttcaaattagtgtccagatataggttctgctgtatatactcatgtacgttggtagcaaataggaagtctgaaaatggatgatgtgtaggtcacatcagttgcaaagaacatttctgtgttttgcctttaaccgccagcaattcttctaggtccacccaggcttcatcctgcaccgtttgaaaccgtggagatgcaatttagggactcaaacgctgcagaactgagctggccatgccgtggttcttgcagggagggatcgtgtggatctcatggccaaaaagcatgtctgatgtcttcagttctgttctccccttgtgacaatttaacaaaggaataaccaaagagaaaccaaaagaagacaaatgtaagggttcatccactcatttccaaaggctcgcttataatagagatttctatacaaaaagctctactgaaaacactggtgttcttctgacctagcacttcattgccaatgcaatatttataattaatttattaaatacatacctctgtttattttgttactgttatttatgctcaaaattctatttatatactcttgaaggtgggttttttggttgtaacaaattttgcgaagttttgtaatcattaaattgtaggaaacaatagctttttaaatctctgttcattattggtagtgtaatatgtacatttgcaataaaaaatcgtcttcagta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]