ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-03 21:23:25, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_204620 1528 bp mRNA linear VRT 01-MAY-2025 DEFINITION Gallus gallus homeobox D11 (HOXD11), mRNA. ACCESSION NM_204620 XM_001234561 VERSION NM_204620.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1528) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1528) AUTHORS Kamiyama,N., Seki,R., Yokoyama,H. and Tamura,K. TITLE Heterochronically early decline of Hox expression prior to cartilage formation in the avian hindlimb zeugopod JOURNAL Dev Growth Differ 54 (6), 619-632 (2012) PUBMED 22708793 REMARK GeneRIF: Expression of Hoxd11/Hoxd12 in the chick hindlimb decreased and disappeared from the presumptive zeugopod region before cartilage formation. REFERENCE 3 (bases 1 to 1528) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1528) AUTHORS Rogina,B., Coelho,C.N., Kosher,R.A. and Upholt,W.B. TITLE The pattern of expression of the chicken homolog of HOX1I in the developing limb suggests a possible role in the ectodermal inhibition of chondrogenesis JOURNAL Dev Dyn 193 (1), 92-101 (1992) PUBMED 1347239 REFERENCE 5 (bases 1 to 1528) AUTHORS Izpisua-Belmonte,J.C., Tickle,C., Dolle,P., Wolpert,L. and Duboule,D. TITLE Expression of the homeobox Hox-4 genes and the specification of position in chick wing development JOURNAL Nature 350 (6319), 585-589 (1991) PUBMED 1673231 REFERENCE 6 (bases 1 to 1528) AUTHORS Nohno,T., Noji,S., Koyama,E., Ohyama,K., Myokai,F., Kuroiwa,A., Saito,T. and Taniguchi,S. TITLE Involvement of the Chox-4 chicken homeobox genes in determination of anteroposterior axial polarity during limb development JOURNAL Cell 64 (6), 1197-1205 (1991) PUBMED 1672266 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000236.1. On Sep 23, 2021 this sequence version replaced NM_204620.1. ##Evidence-Data-START## Transcript exon combination :: M81249.1, JF317542.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992428 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-680 JAENSK010000236.1 8573238-8573917 c 681-1528 JAENSK010000236.1 8571791-8572638 c FEATURES Location/Qualifiers source 1..1528 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="7" /map="7" gene 1..1528 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="homeobox D11" /db_xref="CGNC:7045" /db_xref="GeneID:395328" exon 1..680 /gene="HOXD11" /gene_synonym="GHOX4.6" /inference="alignment:Splign:2.1.0" misc_feature 35..37 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="upstream in-frame stop codon" CDS 74..916 /gene="HOXD11" /gene_synonym="GHOX4.6" /note="homeodomain-containing protein; homeo box D11; chox-4E; chox-4.6; ghox-4.6; homeobox protein Hox-4E; homeobox protein Hox-4.6; Hox D11" /codon_start=1 /product="homeobox protein Hox-D11" /protein_id="NP_989951.1" /db_xref="CGNC:7045" /db_xref="GeneID:395328" /translation="
MTEFDDCSHGASNMYLPGCAYYVSPSDFSTKPSFLSQSSSCQMTFPYSSNLPHVQPVREVAFREYGLERGKWQYRGSYAPYYSAEEVMHRDFLQPANRRTEMLFKTDPVCGHHGASPAASNFYGSVGRNGILPQGFDQFYEPAPAPPYQQHSEGEGDADKGELKPQHSACSKAPSGQEKKVTTASGAASPPGEAVAEKSNSSAVPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLNRDRLQYFTGNPLF"
misc_feature 149..520
/gene="HOXD11"
/gene_synonym="GHOX4.6"
/note="Protein of unknown function (DUF3528); Region:
DUF3528; pfam12045"
/db_xref="CDD:432284"
misc_feature 476..706
/gene="HOXD11"
/gene_synonym="GHOX4.6"
/note="propagated from UniProtKB/Swiss-Prot (P24342.2);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 698..868
/gene="HOXD11"
/gene_synonym="GHOX4.6"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
exon 681..1528
/gene="HOXD11"
/gene_synonym="GHOX4.6"
/inference="alignment:Splign:2.1.0"
ORIGIN
ctcttgtgcaatagatggatctcgttcaacgcattgaagcctcccggtcgctcgcaatcgcgaaaaggaagacatgaccgagtttgacgattgcagtcacggcgcatccaatatgtatctgccagggtgcgcttattacgtctcgccctcagacttctcgacgaaaccctcttttttgtcgcaatcgtcttcctgtcaaatgacttttccttattcttctaatttacctcatgtccaacctgtgcgcgaagtggcattcagggaatacggattagagcgcggcaaatggcagtacaggggcagttacgctccctattactcagctgaagaggtgatgcacagagactttctgcagcccgcgaacaggaggacggaaatgctattcaaaacggaccccgtgtgcggccaccacggagcgtcccccgccgcctccaacttctacggctcggtggggaggaacggcatcctgccgcagggcttcgaccagttctacgagccggcccccgcgcccccgtaccagcagcactccgagggcgagggggacgcggacaagggcgagctgaagccccagcacagcgcctgcagcaaggcaccttccggccaggagaagaaagtgacaacggcgagcggcgccgcttcccctcccggtgaggctgttgcagagaagagcaacagttcagcagttcctcagcgatcgaggaaaaagaggtgtccctataccaaatatcagataagagaactggaacgtgagtttttcttcaacgtgtacataaacaaagagaaaagactgcagttgtccagaatgctcaacctcactgaccggcaagttaaaatctggttccagaatcgaaggatgaaagaaaagaaactgaacagagatcgactccaatacttcactggaaatcccttgttttgaggaggaaaaaaagaaagaaaaaaaaaagaaaggaaaaaaaaaagaaaggaaaaaatgtaaaaaaaaaaaaaatcgaaagagaaagagaaaaggaagaaagaagaagaagcaaagaatccctcggtcagtgtgacctgccatccgaatgccaagtgaatgggtttacatgacacagccgccctgcggaactcaaagtttcatttccatgcgcagctccacacgctgaatggccacaggagatttcggggcttggcggagcagattcctgctaagggaacctagagtaaagccagctgtctattctcaagtggttctcgccaaaggtgcttttttttttctcctctcctctcccacagtaccagcaatggacctgcagtgtgtctggtagtttttgcttacgattcattgagttcggggggggctatgttgttgcttttgagttagggtaacactttcctcccctcaagtgaatgcggtttatttaagagatggtaaatgtacgttcgctatatataaaatatatatatatatatgtttctattgtcatccaaaagcatgggccactgtctttttcatgtgaataaatggtttctagtaaagctaaggttataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]