GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-29 20:19:56, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       NM_204201               1752 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus claudin 5 (CLDN5), mRNA.
ACCESSION   NM_204201
VERSION     NM_204201.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1752)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1752)
  AUTHORS   Collins MM, Baumholtz AI and Ryan AK.
  TITLE     Claudin-5 expression in the vasculature of the developing chick
            embryo
  JOURNAL   Gene Expr Patterns 12 (3-4), 123-129 (2012)
   PUBMED   22326481
  REMARK    GeneRIF: Claudin-5 is the only endothelial claudin expressed during
            chick development.
REFERENCE   3  (bases 1 to 1752)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1752)
  AUTHORS   Rizzolo LJ, Chen X, Weitzman M, Sun R and Zhang H.
  TITLE     Analysis of the RPE transcriptome reveals dynamic changes during
            the development of the outer blood-retinal barrier
  JOURNAL   Mol Vis 13, 1259-1273 (2007)
   PUBMED   17679949
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000260.1.
            
            On Oct 5, 2021 this sequence version replaced NM_204201.1.
            
            ##Evidence-Data-START##
            Transcript is intronless :: AF334678.1, CO421331.1 [ECO:0000345]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1752              JAENSK010000260.1  722599-724350       c
FEATURES             Location/Qualifiers
     source          1..1752
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="15"
                     /map="15"
     gene            1..1752
                     /gene="CLDN5"
                     /note="claudin 5"
                     /db_xref="CGNC:49011"
                     /db_xref="GeneID:374028"
     exon            1..1752
                     /gene="CLDN5"
                     /inference="alignment:Splign:2.1.0"
     CDS             90..740
                     /gene="CLDN5"
                     /codon_start=1
                     /product="claudin-5"
                     /protein_id="NP_989532.1"
                     /db_xref="CGNC:49011"
                     /db_xref="GeneID:374028"
                     /translation="
MASAAVEILGLGLGILGWVGVILACGLPMWQVSAFIDVNIVVAQTIWEGLWMNCVVQSTGQMQCKVYDSILALRPEVQAGRALTVIVALLGLVALMVTVVGAQCTNCIRPGKMKSRIVIAGGTIYILCGVLVLVPLCWFANIVISDFYDPSVPPSQKREIGAALYIGWAATALLLFGGCLICCCSCLQRDETSFPVKYSAPRRPTSSGEYDKKNYV"
     misc_feature    177..629
                     /gene="CLDN5"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
agagcggctcggcagttgtggccggggtcggaggtgcggagccgctgtcctttccccgcgggtttccgaagagcagcggcagcggcggcatggcttcggcggcggtggagattttggggctgggactgggcatcctgggctgggtgggggtgatcctggcctgcgggctgcccatgtggcaggtgtcagccttcatcgacgtgaacatcgtggtggcgcagaccatctgggaagggctgtggatgaactgcgtggtgcagagcacggggcagatgcagtgcaaggtgtacgattccatcctggcgctgcggccggaggtgcaggcgggccgggcgctcacggtcatcgtggcgctgctggggctggtggcgctcatggtcaccgtggtgggcgcgcagtgcaccaactgcatccggcccggcaagatgaagtcccgcatcgtgatcgccggagggaccatctacatcctctgcggggtcctggtcctcgtcccgctctgctggttcgccaacatcgtcatcagcgacttctacgacccctccgtgccgccgtcccagaagcgggagataggggccgcgctgtacatcggctgggcggccacggctctgctgcttttcgggggctgcctcatctgctgctgctcctgcttgcagcgcgacgagacctccttccccgtcaagtactcggcgccgcggcggcccacctccagcggcgagtacgacaagaagaactacgtctgagcggggccgcccgctccgcccggtcgtgcgggcacacggacagacggcgccgccggccgggagcgactgcggtgagctcggccgacgggcgccgcggcgctcctcatcccggagcccgcccagccgcggcaccacagcggcggcagccccgggcagagcggcgtcctgccggcccgcctctccgtcggagcgccgcgtcgggtcctgcccctgcccagcccggccagcgctgcccggcccggcggcaccgccgcgctgctggagcggagccgggagtggtgcggagccgctggtgcctctctgcgcgctgccgggccgtcgtgcgtgccctgtcggggaggagaagcttcccttcttcgttctatctcctgaaaacctgcagctgactgacttctgccatggctttaactggttaaggtttttccttttgttctttgtgggcagctaaactcgggttcctatctgaaggaagactctaaccttggtccttaatcatgcaggcaaataactgcttggagaaaggcacgtcgttttgttccgttgttttgggccctcaaagcgctgatctgtgcgcctttgagacttttgaaagtgatttcagatagctgctgttgctcagcagagaacaaaagccattattccaggttctccatcacttctccttcgtcagcttctgtccttcttgtacttgaatacgaactcattgcaggtcgccagagatacagggggactaaatgcagagacctgggagatctttgtgccctggctccagcacggcgtccctctgtgcctctcgtctgtactacaggagactggaaacaaacctttccctcgctcgtgatgcttaggctatgagaggcttcgtggccttcttgctgagcacttctcgctgccaaatctgaatcacatgtgctcagctggacatacacatgctcggctccccactgtaacttcggtaacatgcacttgccttaatttaattaatcgggcaaataaattaaatgctagagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]