LOCUS       NM_204159               1319 bp    mRNA    linear   VRT 08-APR-2024
DEFINITION  Gallus gallus distal-less homeobox 5 (DLX5), mRNA.
ACCESSION   NM_204159 XM_429224
VERSION     NM_204159.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1319)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1319)
  AUTHORS   Quach,A., MacKenzie,R.K. and Bendall,A.J.
  TITLE     Measuring inputs to a common function: The case of Dlx5 and Dlx6
  JOURNAL   Biochem Biophys Res Commun 478 (1), 371-377 (2016)
   PUBMED   27416760
  REMARK    GeneRIF: We find Dlx5 and Dlx6 to be quantitatively
            indistinguishable on a variety of natural cis-regulatory sequences
            in a heterologous cellular context but observed quantitatively
            different transcriptional outputs in cells that normally express
            these genes, suggesting differential interactions with co-evolved
            co-activators.
REFERENCE   3  (bases 1 to 1319)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1319)
  AUTHORS   Gitton,Y., Benouaiche,L., Vincent,C., Heude,E., Soulika,M.,
            Bouhali,K., Couly,G. and Levi,G.
  TITLE     Dlx5 and Dlx6 expression in the anterior neural fold is essential
            for patterning the dorsal nasal capsule
  JOURNAL   Development 138 (5), 897-903 (2011)
   PUBMED   21270050
  REMARK    GeneRIF: ectethmoid formation depends upon Dlx5 and Dlx6 expression
            in a restricted ectodermal territory of the anterior neural folds
REFERENCE   5  (bases 1 to 1319)
  AUTHORS   Holleville,N., Mateos,S., Bontoux,M., Bollerot,K. and
            Monsoro-Burq,A.H.
  TITLE     Dlx5 drives Runx2 expression and osteogenic differentiation in
            developing cranial suture mesenchyme
  JOURNAL   Dev Biol 304 (2), 860-874 (2007)
   PUBMED   17335796
  REMARK    GeneRIF: Dlx5 and related Dlx factors play a pivotal role in the
            onset of differentiation of chick calvaria osteoblasts.
REFERENCE   6  (bases 1 to 1319)
  AUTHORS   Hsu,S.H., Noamani,B., Abernethy,D.E., Zhu,H., Levi,G. and
            Bendall,A.J.
  TITLE     Dlx5- and Dlx6-mediated chondrogenesis: Differential domain
            requirements for a conserved function
  JOURNAL   Mech Dev 123 (11), 819-830 (2006)
   PUBMED   17027239
  REMARK    GeneRIF: investigated the domain requirements and transcriptional
            activities associated with Dlx5- and Dlx6-mediated chondrogenesis
REFERENCE   7  (bases 1 to 1319)
  AUTHORS   Brown,S.T., Wang,J. and Groves,A.K.
  TITLE     Dlx gene expression during chick inner ear development
  JOURNAL   J Comp Neurol 483 (1), 48-65 (2005)
   PUBMED   15672396
  REMARK    GeneRIF: Inner ear expression patterns of Dlx3, Dlx5, and Dlx6 were
            examined during the first 7 days of chicken embryonic development.
REFERENCE   8  (bases 1 to 1319)
  AUTHORS   Bendall,A.J., Hu,G., Levi,G. and Abate-Shen,C.
  TITLE     Dlx5 regulates chondrocyte differentiation at multiple stages
  JOURNAL   Int J Dev Biol 47 (5), 335-344 (2003)
   PUBMED   12895028
  REMARK    GeneRIF: Dlx5 has roles during multiple stages of chondrocyte
            differentiation and is a general regulator of differentiation in
            the skeleton
REFERENCE   9  (bases 1 to 1319)
  AUTHORS   Borghjid,S. and Siddiqui,M.A.
  TITLE     Chick homeobox gene cDlx expression demarcates the forebrain
            anlage, indicating the onset of forebrain regional specification at
            gastrulation
  JOURNAL   Dev Neurosci 22 (3), 183-196 (2000)
   PUBMED   10894982
REFERENCE   10 (bases 1 to 1319)
  AUTHORS   Ferrari,D., Sumoy,L., Gannon,J., Sun,H., Brown,A.M., Upholt,W.B.
            and Kosher,R.A.
  TITLE     The expression pattern of the Distal-less homeobox-containing gene
            Dlx-5 in the developing chick limb bud suggests its involvement in
            apical ectodermal ridge activity, pattern formation, and cartilage
            differentiation
  JOURNAL   Mech Dev 52 (2-3), 257-264 (1995)
   PUBMED   8541214
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000036.1.
            
            On Sep 23, 2021 this sequence version replaced NM_204159.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U25274.1, HAEL01001953.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN02738221, SAMN02738223
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-424               JAENSK010000036.1  16505657-16506080   c
            425-609             JAENSK010000036.1  16504638-16504822   c
            610-1319            JAENSK010000036.1  16503797-16504506   c
FEATURES             Location/Qualifiers
     source          1..1319
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
     gene            1..1319
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /note="distal-less homeobox 5"
                     /db_xref="CGNC:48983"
                     /db_xref="GeneID:373969"
     exon            1..424
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /inference="alignment:Splign:2.1.0"
     CDS             73..933
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /note="distal-less homeo box 5; cDlx"
                     /codon_start=1
                     /product="homeobox protein DLX-5"
                     /protein_id="NP_989490.1"
                     /db_xref="CGNC:48983"
                     /db_xref="GeneID:373969"
                     /translation="

MTAVFDRRVPGIRSSDFQPPFQSAAAMHHPSQESPTLPESSATDSDYYSPTGAAPHGYCSPTSASYGKALNPYQYQYGMNGSAGTYPAKAYADYGYGSPYHQYGGAYGRGQSSAGQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLGHHGHGHPPAANPSPGSYLESPSAWYPAASPLGSHLQPHGSLQHPLALPSGTIY"

     misc_feature    73..228
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /note="propagated from UniProtKB/Swiss-Prot (P50577.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    166..423
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:463567"
     misc_feature    481..651
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    661..930
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /note="propagated from UniProtKB/Swiss-Prot (P50577.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            425..609
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /inference="alignment:Splign:2.1.0"
     exon            610..1319
                     /gene="DLX5"
                     /gene_synonym="DLX-5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agcagtctgccgcagccgccgcgccgagccgcctcccccggccatgtccgcctgagcccggcgatccgcgctatgacagcagtgtttgacagaagggtccccggcatcaggtcctccgacttccagccgcctttccagagcgccgcagccatgcaccacccgtcccaggaatctcccactttacccgagtcctcggctacggattccgactactacagcccgacgggggcggccccgcacggctactgctcgcctacctcggcttcctacggcaaagcgctcaacccctaccagtaccagtacggcatgaacggctccgccggcacctaccccgccaaagcctacgcggactacggctacggcagcccctaccaccagtacggaggcgcctacggccgcgggcaaagctccgcggggcagccagagaaggaggtggcggagcccgaggtgaggatggtgaacggcaagccaaagaaagtgcgcaaaccgcggactatttattccagctttcagctggcggcgttgcagaggaggttccagaagacccaatacctcgccctgcccgagcgggccgagctggccgcctcgctgggactcacgcagacgcaggtgaaaatctggttccagaacaaaaggtccaagatcaagaagatcatgaagaacggggagatgcccccggagcacagccccagctccagcgaccccatggcctgcaactccccgcagtcgccggcggtgtgggaacctcagggctcgtcgcgctccctcggccaccacgggcacgggcacccgcccgccgccaacccgtcccccggcagctacctggagagcccctcggcctggtaccccgccgccagccccctcggctcccacctgcagccccacggctccctacagcatcccttggcgctgccctccgggacgatctactgagggccgaaccctcgtgcttcttttgtattccgctccctggactcctgtgttttactgttaaggaagaataacgaaaggaatgcggatgggggatttttaaagggaaacgaaacaaacaaacgacgacgacaacgacaaacaaacaaacaaaaaaaaaaggttaaaatgtgtaaagcttgtgcatgtaacttattgcatttcaaaggaacccttttttataccgtgcggacgttttttcggctcagctgtggacactgtcaatggtgccttcaaatctatgacctcaacttttccagagactttttttcaatgttattttaacccttgtaaataattgtagatagaggaattaaactgtatattctgaataaaataaaattatttcg

//