GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-19 08:49:39, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001398309             880 bp    mRNA    linear   VRT 08-APR-2024
DEFINITION  Gallus gallus homeobox A6 (HOXA6), transcript variant 2, mRNA.
ACCESSION   NM_001398309
VERSION     NM_001398309.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 880)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 880)
  AUTHORS   Attia,L., Yelin,R. and Schultheiss,T.M.
  TITLE     Analysis of nephric duct specification in the avian embryo
  JOURNAL   Development 139 (22), 4143-4151 (2012)
   PUBMED   23034630
  REMARK    GeneRIF: In the primitive streak, expression of the gene HoxB4 is
            associated with prospective duct IM, whereas expression of the more
            posterior Hox gene HoxA6 is associated with more posterior,
            non-duct-forming IM.
REFERENCE   3  (bases 1 to 880)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000037.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13267647.12816.1, HAEL01011072.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-328               JAENSK010000037.1  1563382-1563709     c
            329-584             JAENSK010000037.1  1559093-1559348     c
            585-880             JAENSK010000037.1  1557598-1557893     c
FEATURES             Location/Qualifiers
     source          1..880
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
     gene            1..880
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="homeobox A6"
                     /db_xref="CGNC:51307"
                     /db_xref="GeneID:420630"
     exon            1..328
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    323..325
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="upstream in-frame stop codon"
     exon            329..584
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /inference="alignment:Splign:2.1.0"
     CDS             560..844
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="isoform 2 is encoded by transcript variant 2;
                     homeobox protein Hox-A6; homeo box A6; homeo box 1B;
                     homeobox protein HOXA6; homeobox protein Hox-1B"
                     /codon_start=1
                     /product="homeobox protein Hox-A6 isoform 2"
                     /protein_id="NP_001385238.1"
                     /db_xref="CGNC:51307"
                     /db_xref="GeneID:420630"
                     /translation="
MQRMNSCAGTVYGAHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKFINSTQPGSDETEEKSGE"
     misc_feature    608..778
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            585..880
                     /gene="HOXA6"
                     /gene_synonym="HOX1; HOX1.2; HOX1B"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
attcttttgctgagctctgtcctgcttcggatctctctggctttcaatccccatttcatttgctctttgtaaggctatagtgaacaaagtgtgcggaggttcggcataagcagccgcctagaacacagatccgggatggcaatttccagttcccccgctggaaggtgtggcatattggattcaaagcactggcgtggcagattttcaacttgcaacctggctaatttcctgcttcttctggcaccaaaaggagggcgattcgtctcctgtgcagccaaagcgacagctgtcaaagtcgcaggggctcctgcgagccagaacctaaaagtccaacaccgtcattgcttgcaatcgggcttcctatgagtacggagcctcctgtttctattcagacaaggaaattagtagcgcctctccctccggcagtggcaagcagaggggacaaggggactatctgcacttttctcccgagcaacaatacaaatccaacggcgtgcaaagcaaaatcgtgaatgacgaaggcaccgaccggaagtacacgagccctgtttacccctggatgcagcggatgaactcctgtgccggtacagtatatggagctcatgggagacgagggaggcagacttacacccgctaccaaacgctagagttagagaaggagttccattttaacagatacttaacccgaagacgacgcattgagattgcgaacgctctctgccttaccgagcgccagattaaaatatggtttcaaaacaggcggatgaaatggaaaaaggaaaacaaattcataaattccacccagcccggcagcgacgaaacagaggaaaagtcaggggagtagaaccgtgtttaataaacgctaccaggcccgtcctta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]