2024-07-03 21:43:51, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001398206 1392 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus homeobox A3 (HOXA3), transcript variant 14, mRNA. ACCESSION NM_001398206 VERSION NM_001398206.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1392) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1392) AUTHORS Han B, Lian L, Li X, Zhao C, Qu L, Liu C, Song J and Yang N. TITLE Chicken gga-miR-130a targets HOXA3 and MDFIC and inhibits Marek's disease lymphoma cell proliferation and migration JOURNAL Mol Biol Rep 43 (7), 667-676 (2016) PUBMED 27178573 REMARK GeneRIF: miR-130a can arrest MSB1 cell proliferation and migration, and target HOXA3 and MDFIC, which are both involved in the regulation of cell proliferation. Collectively, gga-miR-130a plays a critical role in the tumorigenesis associated with chicken Marek's disease. REFERENCE 3 (bases 1 to 1392) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1392) AUTHORS Watari-Goshima N and Chisaka O. TITLE Chicken HOXA3 gene: its expression pattern and role in branchial nerve precursor cell migration JOURNAL Int J Biol Sci 7 (1), 87-101 (2011) PUBMED 21278919 REMARK GeneRIF: HOXA3 function is required for the migration of epibranchial placode-derived cells. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1392) AUTHORS Searcy RD and Yutzey KE. TITLE Analysis of Hox gene expression during early avian heart development JOURNAL Dev Dyn 213 (1), 82-91 (1998) PUBMED 9733103 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000037.1. ##Evidence-Data-START## Transcript exon combination :: SRR13267659.254191.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992432, SAMEA103992440 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-107 JAENSK010000037.1 1531386-1531492 c 108-696 JAENSK010000037.1 1522597-1523185 c 697-1392 JAENSK010000037.1 1517767-1518462 c FEATURES Location/Qualifiers source 1..1392 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="2" /map="2" gene 1..1392 /gene="HOXA3" /note="homeobox A3" /db_xref="CGNC:49224" /db_xref="GeneID:395231" exon 1..107 /gene="HOXA3" /inference="alignment:Splign:2.1.0" exon 108..696 /gene="HOXA3" /inference="alignment:Splign:2.1.0" misc_feature 204..206 /gene="HOXA3" /note="upstream in-frame stop codon" CDS 225..764 /gene="HOXA3" /note="isoform b is encoded by transcript variant 14; homeodomain protein HOXD-3; homeobox protein Hox-A3; homeo box A3; homeobox protein Hox-D3" /codon_start=1 /product="homeobox protein Hox-A3 isoform b" /protein_id="NP_001385135.1" /db_xref="CGNC:49224" /db_xref="GeneID:395231" /translation="
MQKATYYDSSAIYGAYPYQGANGFTYNASQQQYPPSSSLVETEYHRPACSLQSPGSAVSHHKANDISESCMRTLPSQPLQPPGLTDPQAPPQPPPAPQAQPPPPSSASPSQNASSNPAPANSTKSPALNSPTVSKQIFPWMKESRQNTKQKNSSSSSEPPLPDAEASPRSRESIESFSA"
misc_feature 438..617 /gene="HOXA3" /note="propagated from UniProtKB/Swiss-Prot (O93353.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 633..650 /gene="HOXA3" /note="propagated from UniProtKB/Swiss-Prot (O93353.2); Region: Antp-type hexapeptide" exon 697..1392 /gene="HOXA3" /inference="alignment:Splign:2.1.0" ORIGIN
gcaaaattcagaggcaagccagtgaaggaaggtgcgtgctccatagtgtggtacaaggacaaaaatcaactagcctcttagaagagagccttttttgcctttgtcaggtctgcccggagcggccattggaggagcagcgccacgtgacagaggggtgccaatgttattctccaagggtgtcaagaccctgtcagtttgcgaaataaatattgggaaacaacgaaatgcaaaaagcgacctactacgacagctctgcaatctatggtgcctacccctaccaaggagcaaatggtttcacttataatgcgagtcagcagcaatatcctccatcttcgtcacttgtggaaactgagtaccaccgccccgcgtgctccctccagtcccctggcagcgccgtgtcccaccacaaggccaatgacatcagtgagagttgcatgaggactctccccagccagcctctgcagccccctggcctcaccgacccgcaggccccgccgcagccacctccagccccgcaggcacagcctccacctccatcctcggcctcaccatctcaaaatgccagcagcaaccctgccccggccaactccactaagagcccggctcttaactcgcctaccgtgtccaaacagatattcccgtggatgaaagagtctcggcaaaacacaaagcagaaaaacagcagttccagttcagagccacccctgcctgatgccgaagcatcgccacgcagccgcgaatctatagagagcttctctgcataagcagataaagagcgctcgggcagagaaaggcattgcggatatacccgcaccatgcggcgccttacgggcggagatgtagaaccgtggaaggttatttcttccgatatttttcatcgaaacccgctcgtcgcccggcacagaccaacgagccgttgttgttctgtaggcaaagaaggcattttggcaccgtcgcgaggcatcgctcgtttccacttagcgaatatagagaacccaaacgccccccacccctcagctaagtgccatagatcaaacaaaaggtaacggtacgggcggtgaagtcgggtcgtgaggcttagcgccaggattgcatctctgaaaatgtccatagagaaggaattcggcttttcttccccctcccactccgaagggagaaaaagccaggcggctttgcccccttctttcctctccccatcctcagagcctgcacgttagcaatacgaatttgtactttcgcattcgagatcctcccgattaaaagatccctctggaggcagaagtaattgatctgcccaagaatttcgcgtcccctctccaaaggttttgttccaggtggtttttgtattagaacgatcacaaggaacaaatgcgcagaatagagacacccacg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]