2024-07-03 21:57:44, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS NM_001389306 2078 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus notochord homeobox (NOTO), transcript variant 2, mRNA. ACCESSION NM_001389306 VERSION NM_001389306.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 2078) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 2078) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 2078) AUTHORS Knezevic V, Ranson M and Mackem S. TITLE The organizer-associated chick homeobox gene, Gnot1, is expressed before gastrulation and regulated synergistically by activin and retinoic acid JOURNAL Dev Biol 171 (2), 458-470 (1995) PUBMED 7556928 REFERENCE 4 (bases 1 to 2078) AUTHORS Ranson M, Tickle C, Mahon KA and Mackem S. TITLE Gnot1, a member of a new homeobox gene subfamily, is expressed in a dynamic, region-specific domain along the proximodistal axis of the developing limb JOURNAL Mech Dev 51 (1), 17-30 (1995) PUBMED 7669689 REFERENCE 5 (bases 1 to 2078) AUTHORS Stein S and Kessel M. TITLE A homeobox gene involved in node, notochord and neural plate formation of chick embryos JOURNAL Mech Dev 49 (1-2), 37-48 (1995) PUBMED 7748788 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000077.1. On Oct 26, 2021 this sequence version replaced NM_001389306.1. ##Evidence-Data-START## Transcript exon combination :: ERR2286007.68100.1 [ECO:0000332] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-230 JAENSK010000077.1 3813767-3813996 c 231-439 JAENSK010000077.1 3813474-3813682 c 440-2078 JAENSK010000077.1 3811485-3813123 c FEATURES Location/Qualifiers source 1..2078 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="4" /map="4" gene 1..2078 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="notochord homeobox" /db_xref="CGNC:49744" /db_xref="GeneID:396302" exon 1..230 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /inference="alignment:Splign:2.1.0" misc_feature 200..202 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="upstream in-frame stop codon" exon 231..439 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /inference="alignment:Splign:2.1.0" CDS 308..598 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="isoform 2 is encoded by transcript variant 2; Gnot1 homeodomain protein" /codon_start=1 /product="notochord homeobox isoform 2" /protein_id="NP_001376235.1" /db_xref="CGNC:49744" /db_xref="GeneID:396302" /translation="
MKRVRTVFKPEQLERLEQEFLKQQYMVGTERVDLAATLRLTETQVKVWFQNRRIKWRKQSMEQKKAKLSQFGVIQPTSAGPTDVKEHEEDTVEVEL"
misc_feature 311..481 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 440..2078 /gene="NOTO" /gene_synonym="CNOT; GNOT1" /inference="alignment:Splign:2.1.0" ORIGIN
atggatggaccaggaaagggagatgatggccttcctaaggagctggggctgaaggggactttgggaacggctctcctgcagaatgctgccagcttcagcatccaagtccatcactaaaccgtgtctcttagtgccacaaagggacatccctgcttttcttttcggtgctccttccttccacccccttgccgttgtaaagtagctgcatttggatttcagccagagcccacgtctggagttgtctcactgcacaggggccgacccgctgggccctgctgtgctgtggaggtctggagggccctgcaaaatgaagagagtgcgcacagtcttcaaaccagagcagttggagaggctggagcaagagttcctcaagcagcagtacatggtgggcacagagcgagtggacctggctgcaacgctgcgtctcacagagacccaggtgaaagtctggttccagaaccggaggatcaaatggaggaagcagagcatggagcagaagaaggcaaagctgtcacagtttggggtgatacagcccacctctgctggccccacggatgtcaaggagcatgaggaggacacagtggaggttgagctttgagcagctgatgggatgcagctgccactgttgtttttgcagccacgcctgcctgatggaggtactggggatgcaggcacatctgtgcttgctttgtccaagctagacttgaagttcttgctctgagagttttgagctacagaactaaactgccattgggtgggaagaagcatccaaaagtgtagagacccctatttggtaaccggtgctgtaactcttggtcttgatggtgccatcgttgtggcaaagcatgtgatctcatttgctctcaaagtgctaggaagcacagtttccaatagagaggctggggtggcggtcagacggtgtctctgatggcagtgagcatggcagcatctgaacatggggtcactcgtgtttcaggtgactgtgtgctcctacgagggagagctgtgctgggaggagatttggctctgatggtttctcctggtcgtcttgattcccatgttggatgctgagatcacaacgacaacaaagtgaaaactgaaaagtcctttgctcccacccgcatcattcttatcattgttgtatttattttcatatatcattcatgcaataaggtgaacagggtctgactctgcccctggagtagaagcgcctctcctcctgtcctgtgccttgctgtcttgcctttcttttgcctttcagagcccagtgtggttttgccttacttcaccatggtgtgcacagggaacaaggggctcctggggctctcaaaggtgcagggaccagggccgttacaaaccagcagctcttcaacacctctgctgcgtcagacggccccctgccctcatccagatgttctggtcctggcccagatggcggctgctcccttctctccttgttacacaccacagcactgtgagaagcagcacctggagagcttggcgagtacatctgcaaccacacactgcagctcgctgtcgtattcctggtgggtgggagggctcggaggggtcaggactgagtattcacgtttccctgtctgtgttttagtaattcctaggggctggtgtgcacagcagcagcagcagcttttggccatgcagccggtgctcaggctgtcacctcatcccagggcaccaggcacaacatctcatgagctcaggataattcatcatgtctctttccaaccccagaatcatagaatcatagaatggcctgggttgaaaaggaccaccaatgatcacccaatttcaacccccctgctatgtgcagggtcgccaaccaccagaccaggctgcccagagccacatccagcctggccttgaatgcttccagggatggggcatccacagcctccttgggcaacctgttccagtgcgtcaccaccctctgagtggaaaaactgtatattgccttcctctagtgttagagagaaaagaaataacatttttttttctttcctccttgccaagtgtcacttctttatttgctttgcttctttaataaagaaagaaactgt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]