GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-16 05:24:09, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001351438             542 bp    mRNA    linear   VRT 23-SEP-2021
DEFINITION  Gallus gallus NK2 homeobox 3 (NKX2-3), mRNA.
ACCESSION   NM_001351438
VERSION     NM_001351438.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 542)
  AUTHORS   Strasser B, Mlitz V, Hermann M, Rice RH, Eigenheer RA, Alibardi L,
            Tschachler E and Eckhart L.
  TITLE     Evolutionary origin and diversification of epidermal barrier
            proteins in amniotes
  JOURNAL   Mol Biol Evol 31 (12), 3194-3205 (2014)
   PUBMED   25169930
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000349.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001351438.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX257576.4, BX257577.4 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992428, SAMEA103992559
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-45                JAENSK010000349.1  823801-823845
            46-542              JAENSK010000349.1  824923-825419
FEATURES             Location/Qualifiers
     source          1..542
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="25"
                     /map="25"
     gene            1..542
                     /gene="NKX2-3"
                     /gene_synonym="EDQM3; NKx-2.3"
                     /note="NK2 homeobox 3"
                     /db_xref="CGNC:80606"
                     /db_xref="GeneID:110224122"
     exon            1..45
                     /gene="NKX2-3"
                     /gene_synonym="EDQM3; NKx-2.3"
                     /inference="alignment:Splign:2.1.0"
     exon            46..542
                     /gene="NKX2-3"
                     /gene_synonym="EDQM3; NKx-2.3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    57..59
                     /gene="NKX2-3"
                     /gene_synonym="EDQM3; NKx-2.3"
                     /note="upstream in-frame stop codon"
     CDS             66..326
                     /gene="NKX2-3"
                     /gene_synonym="EDQM3; NKx-2.3"
                     /codon_start=1
                     /product="epidermal differentiation protein containing a
                     glutamine (Q) motif 3"
                     /protein_id="NP_001338367.1"
                     /db_xref="CGNC:80606"
                     /db_xref="GeneID:110224122"
                     /translation="
MCSRADRGCHSSESSSCHSGGSSCHGSEEVTCHEVSAVQDGTPVVVLQPQCPVVTVPTQGPVAPVPCQQQQQQIKQPVQWPTQQQK"
ORIGIN      
tcattcactcggctccgttccctctgagcaacctttccagacaagggctcctgctctgatcgaagatgtgctcccgtgctgacagaggctgccacagctctgagagctcctcctgccacagcggaggttcctcctgccatggctctgaggaggtcacctgccacgaagtgagcgccgtgcaggatgggacgcccgtggtggtcctgcagcctcagtgccctgtggtcaccgtgcccactcagggccccgtggctcccgtcccatgccagcagcaacagcaacagatcaagcagccggtgcaatggcccacgcagcagcagaagtgaaggggctgcgctcatccctcatctctgcagggcacagccctgagcagcaggagcagctcctgcccctcccctccagcacatattgcctctcctgatgctgtgacggagcgttggcacgtcagaaatgtgatttgcccacttgcatttgtatccgttattttcctgcttctgtatccagtagcaaagacgtgatattaaaatgtaaagctcacaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]