LOCUS       NM_001320906            1209 bp    mRNA    linear   VRT 03-APR-2025
DEFINITION  Gallus gallus LIM homeobox 5 (LHX5), mRNA.
ACCESSION   NM_001320906 XM_001234552
VERSION     NM_001320906.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1209)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1209)
  AUTHORS   Inoue,J., Ueda,Y., Bando,T., Mito,T., Noji,S. and Ohuchi,H.
  TITLE     The expression of LIM-homeobox genes, Lhx1 and Lhx5, in the
            forebrain is essential for neural retina differentiation
  JOURNAL   Dev Growth Differ 55 (7), 668-675 (2013)
   PUBMED   24024588
  REMARK    GeneRIF: Results suggest that Lhx1 and Lhx5 in the forebrain
            regulate neural retina differentiation by suppressing the
            development of the retinal pigment epithelium, before the formation
            of the optic vesicle (OV).
REFERENCE   3  (bases 1 to 1209)
  AUTHORS   Kawaue,T., Okamoto,M., Matsuyo,A., Inoue,J., Ueda,Y., Tomonari,S.,
            Noji,S. and Ohuchi,H.
  TITLE     Lhx1 in the proximal region of the optic vesicle permits neural
            retina development in the chicken
  JOURNAL   Biol Open 1 (11), 1083-1093 (2012)
   PUBMED   23213388
REFERENCE   4  (bases 1 to 1209)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB485718.1.
            
            On Mar 9, 2016 this sequence version replaced XM_001234552.4.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB485718.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992393, SAMEA103992482
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1209
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="15"
                     /map="15"
     gene            1..1209
                     /gene="LHX5"
                     /note="LIM homeobox 5"
                     /db_xref="CGNC:6292"
                     /db_xref="GeneID:771259"
     CDS             1..1209
                     /gene="LHX5"
                     /note="LIM homeobox protein 5"
                     /codon_start=1
                     /product="LIM/homeobox protein Lhx5"
                     /protein_id="NP_001307835.1"
                     /db_xref="CGNC:6292"
                     /db_xref="GeneID:771259"
                     /translation="

MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFGTKCAGCSQGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYLNSPSLKEGSLNSVSSCTDRSLSPDLQDPMQDDTKETDNSTSSDKETTNNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYGPGGNYDFFPHGPPSQAQSPADPSYLQNSGPGSTPLGPLEPPLSGHHSSENQRYTDMISHPDTPSPEPGMTGSLHPIPGEVFSGGPSPPFSMSSNSGYSGALAHPNPELSEAAVW"

     misc_feature    13..168
                     /gene="LHX5"
                     /note="The first LIM domain of Lhx1 (also known as Lim1)
                     and Lhx5; Region: LIM1_Lhx1_Lhx5; cd09367"
                     /db_xref="CDD:188753"
     misc_feature    order(13..15,22..24,76..78,85..87,94..96,103..105,
                     154..156,163..165)
                     /gene="LHX5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188753"
     misc_feature    190..357
                     /gene="LHX5"
                     /note="The second LIM domain of Lhx1 (also known as Lim1)
                     and Lhx5; Region: LIM2_Lhx1_Lhx5; cd09375"
                     /db_xref="CDD:188761"
     misc_feature    order(190..192,199..201,256..258,265..267,274..276,
                     283..285,343..345,352..354)
                     /gene="LHX5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188761"
     misc_feature    541..711
                     /gene="LHX5"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            1..173
                     /gene="LHX5"
                     /inference="alignment:Splign:2.1.0"
     exon            174..397
                     /gene="LHX5"
                     /inference="alignment:Splign:2.1.0"
     exon            398..675
                     /gene="LHX5"
                     /inference="alignment:Splign:2.1.0"
     exon            676..841
                     /gene="LHX5"
                     /inference="alignment:Splign:2.1.0"
     exon            842..1209
                     /gene="LHX5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgatggtgcattgtgcgggctgcgagaggccgattttggaccgcttcctgctgaacgtcttggacagggcatggcacatcaaatgcgtccagtgctgcgagtgcaaatgcaacctgaccgagaaatgcttctccagggaaggaaaactctactgcaagaatgactttttcaggaggtttggcaccaaatgcgccggctgctcccagggcatctcccccagcgacctagtccggaaagcccggaacaaagtgttccacctgaactgtttcacctgcatggtttgcaacaagcagctctccacgggcgaggaactgtatatcatagacgaaaacaaatttgtttgcaaagaggactatttgaactctcccagtttgaaggaaggcagcctcaactcagtgtcctcatgtacagacaggagtttgtccccggatctccaggaccccatgcaggacgacaccaaggagacggacaattccacctcctcagacaaggagaccaccaacaacgagaacgaggagcagaactcgggcaccaagcggcgggggccccgcaccaccattaaggccaagcagctggagaccctcaaagctgccttcgcggccactcccaagcccacccggcacatccgtgagcaactggcccaggagacgggcctcaacatgagggtcatccaggtctggttccagaaccgccggtccaaggagcgccggatgaagcagctgagcgcactgggcgcccgccggcacgccttcttccgcagcccgcgcaggatgcggcccctgggtggccgcctcgatgagtctgagatgcttggctcgacgccctacacgtactacggagattaccaaggtgattactacggcccgggaggcaactatgactttttcccccatgggcccccctcccaggcccagtccccggccgaccccagctaccttcagaactcaggacctggctccactcccctgggacccttggagcccccccttagcggacaccactcctcagaaaaccaaaggtacacggatatgatctcgcaccccgacacccccagccccgagccggggatgacgggctcgctgcaccccatcccgggggaggtcttcagtggggggcccagcccgcccttctccatgtccagcaatagcggctacagcggggcactcgcgcaccccaacccggagctcagcgaggcagcggtgtggtag

//