GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-23 01:25:20, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001277723            2562 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus four and a half LIM domains 5 (FHL5), mRNA.
ACCESSION   NM_001277723 XM_419829
VERSION     NM_001277723.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 2562)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 2562)
  AUTHORS   Oshiumi H, Shida K, Goitsuka R, Kimura Y, Katoh J, Ohba S, Tamaki
            Y, Hattori T, Yamada N, Inoue N, Matsumoto M, Mizuno S and Seya T.
  TITLE     Regulator of complement activation (RCA) locus in chicken:
            identification of chicken RCA gene cluster and functional RCA
            proteins
  JOURNAL   J Immunol 175 (3), 1724-1734 (2005)
   PUBMED   16034113
  REMARK    GeneRIF: Chicken regulator of complement genes CREM
            (cAMP-responsive element modulator), CREG, and CRES are located in
            a single locus; expression of CREM on hamster CHO cells blocks
            chicken serum-mediated cytotoxicity
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000065.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001277723.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: ERR2365562.92492.1, BX929623.2
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992531 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-237               JAENSK010000065.1  9789715-9789951     c
            238-269             JAENSK010000065.1  9789444-9789475     c
            270-440             JAENSK010000065.1  9772822-9772992     c
            441-615             JAENSK010000065.1  9770326-9770500     c
            616-785             JAENSK010000065.1  9768380-9768549     c
            786-972             JAENSK010000065.1  9764887-9765073     c
            973-2562            JAENSK010000065.1  9762092-9763681     c
FEATURES             Location/Qualifiers
     source          1..2562
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="3"
                     /map="3"
     gene            1..2562
                     /gene="FHL5"
                     /note="four and a half LIM domains 5"
                     /db_xref="CGNC:11609"
                     /db_xref="GeneID:421803"
     exon            1..237
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    195..197
                     /gene="FHL5"
                     /note="upstream in-frame stop codon"
     exon            238..269
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
     exon            270..440
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
     CDS             282..1121
                     /gene="FHL5"
                     /note="activator of cAMP-responsive element modulator
                     (CREM) in testis"
                     /codon_start=1
                     /product="four and a half LIM domains protein 5"
                     /protein_id="NP_001264652.1"
                     /db_xref="CGNC:11609"
                     /db_xref="GeneID:421803"
                     /translation="
MTSNHSDCHYCLQSLRGRKYALKEENAYCVRCYDSLFANSCEECKEPIECDSKDLAYKGRHWHERCFKCTKCSRSLVEKPFAAKDELLLCTECYSNEYSSKCFHCQKTIMPGSRKMEFKGSSWHESCFVCQYCQQPLGTKPLITKDNENYCVPCFEKQFAHRCYSCKKVITSGGVAYHDQPWHKECFVCAGCKTQLSGQRFVSKDEYPYCVDCFSKFYAKKCTACKKPITALGGAKFVSFEECQWHEECFNCARCSVSLVGQGFLTKQDAVLCHECGSS"
     misc_feature    390..566
                     /gene="FHL5"
                     /note="The first LIM domain of Four and a half LIM domains
                     protein (FHL); Region: LIM1_FHL; cd09343"
                     /db_xref="CDD:188729"
     misc_feature    order(402..404,411..413,468..470,477..479,486..488,
                     495..497,549..551,558..560)
                     /gene="FHL5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188729"
     misc_feature    585..746
                     /gene="FHL5"
                     /note="The second LIM domain of Four and a half LIM
                     domains protein 5 (FHL5); Region: LIM2_FHL5; cd09428"
                     /db_xref="CDD:188812"
     misc_feature    order(585..587,594..596,651..653,660..662,669..671,
                     678..680,732..734,741..743)
                     /gene="FHL5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188812"
     misc_feature    768..923
                     /gene="FHL5"
                     /note="The third LIM domain of Four and a half LIM domains
                     protein (FHL); Region: LIM3_FHL; cd09346"
                     /db_xref="CDD:188732"
     misc_feature    order(768..770,777..779,828..830,837..839,846..848,
                     855..857,909..911,918..920)
                     /gene="FHL5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188732"
     misc_feature    945..1112
                     /gene="FHL5"
                     /note="The fourth LIM domain of Four and a half LIM
                     domains protein (FHL); Region: LIM4_FHL; cd09347"
                     /db_xref="CDD:188733"
     misc_feature    order(945..947,954..956,1017..1019,1026..1028,1035..1037,
                     1044..1046,1098..1100,1107..1109)
                     /gene="FHL5"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188733"
     exon            441..615
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
     exon            616..785
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
     exon            786..972
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
     exon            973..2562
                     /gene="FHL5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gtatgcaacagtcataggttagtaatcacgactttttcccttctctgaattacaagcccaagtgaggtcttttggattccttctttgtgggccacagcgtagctggggacaagtggtgatccatcattttattttttctttctactaaagagtttcagggttttgagtttttagcagaagtacctttttctttttgacaactgtctgaaatatgttcctttgagatcctcctacacgaagttaccaggagaagcagcttggaactaaataactccaccagaatgaccagcaatcactcagactgccattactgcctgcagtctctccgtggaaggaagtatgcattaaaggaagagaatgcttattgtgttagatgctatgacagcctatttgccaactcctgtgaggagtgcaaggaacctattgaatgtgattccaaggatctggcttacaaaggccgccactggcacgagaggtgtttcaagtgcaccaaatgcagccgttctctggtagagaaaccattcgctgccaaggatgagctcttgctctgtactgaatgttactccaatgagtattcatcaaagtgtttccactgccagaagaccatcatgcctggttcccgtaaaatggaatttaagggcagttcctggcatgaatcctgttttgtttgtcagtattgccagcaaccactgggaacaaaaccactgatcaccaaagacaatgagaattactgcgtaccctgttttgagaaacaatttgctcatcgttgctactcttgcaaaaaggtaataacttctgggggagtggcctaccacgaccagccttggcataaagagtgctttgtgtgtgctggatgtaaaactcagctgtctgggcaaaggtttgtttccaaagatgagtatccatactgtgtagattgtttcagcaagttttatgctaagaagtgtactgcttgcaagaaacctattacagctcttggaggtgccaaatttgtctcatttgaagagtgtcagtggcatgaggaatgttttaactgtgcaagatgctcagtctcactggtgggccaaggattcctcaccaagcaggatgcagtcctttgccatgaatgtggttcttcgtagttctgtggagagctataaagatgaattattctcactatataaccatgtactttgttactctgcagtaagaaaatcatttaaaaggtgtatcacttatttagcaattcaagtaactttccaacagcagtttaattccatcacagttgtgaacttcttgttataaaaataaataaataaacagccacatactgcctcagaaaacagtgcagaaaagattagtatatattttaaatataactgcagtatgtttctccttgtaacacactgcactctgctgttagaaactttaactttcatttcccacgaaccaaggaggtgtatagaaagtctatgtgacatatatctagttatgaggcattagcattgcaagtgaggaggaggtacgtgtacacaaagagacaccaagtcagggaaatccattccagggccagagaaagggataaaagatcctttccctctctttattgatattgttgagagtgctcatcagaaaaatagaatttcccataaatttagtcatccaaaaaactgaacgataggtcctttcccaaaactggtcaattgcattttatttttcaggcataaatgttttagaacatgaacaaacccttttttaattttaatttttatttttaaatctactgtaagaggtacagattgcccaaggttggatagtggtaatgtatagtttccaatatctaatatgatttaaaactgtctccattatcttcactagaccttcaagtgcactcttaaaatatagtttctcttatttgaggcaagagccaacacacagctgtccctttaaactacatttttcctcccttcaacactcatttgccagcagtcaaaatactgataatggctttaccatttctgcactgcagtctttgattcacagtcaactccttttcttgtaaacgtccacttgtctgtagcaggctatcagctgctcagagccaatacctagttcattctgccacgtgccaacatgcatgtgccaatattatgtcaagaatttgtaatgttgccatatcaaggtaggcagtgctcacatgtagtaccaggtagtagtttctctttccttagctcatgctatatacacactatatgttacaatggcctgactcattctgcagtatctctaccaggccatggtgtaggataccgcggttctatgcctattagatgttgttttgctcctcatctcacgtgtctgaaaattgttctcctttagactctgatgttgaaaacttacagttatttgtctgacttgagagcactttattcatactgaattatgtagatgctgcttcaagtagaaaaaggagaaaaaaagaacttgtaagcatagctaagccagagctatatggcagtggcataaaatcaacaagtacatagcaatctgtttcccaatcaataaagtattaatcttctgcta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]