GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-07-03 05:16:00, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001277553            1178 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus GRB2 related adaptor protein like (GRAPL), mRNA.
ACCESSION   NM_001277553 XM_003642116 XM_414827
VERSION     NM_001277553.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1178)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1178)
  AUTHORS   Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
            Korn B and Buerstedde JM.
  TITLE     A large database of chicken bursal ESTs as a resource for the
            analysis of vertebrate gene function
  JOURNAL   Genome Res 10 (12), 2062-2069 (2000)
   PUBMED   11116100
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000257.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001277553.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX931837.2, HAEK01072420.1
                                           [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA103992290,
                                           SAMEA103992323 [ECO:0006172]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-180               JAENSK010000257.1  5175338-5175517     c
            181-278             JAENSK010000257.1  5174273-5174370     c
            279-401             JAENSK010000257.1  5173189-5173311     c
            402-570             JAENSK010000257.1  5172300-5172468     c
            571-1178            JAENSK010000257.1  5171474-5172081     c
FEATURES             Location/Qualifiers
     source          1..1178
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="14"
                     /map="14"
     gene            1..1178
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="GRB2 related adaptor protein like"
                     /db_xref="CGNC:50277"
                     /db_xref="GeneID:416523"
     exon            1..180
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /inference="alignment:Splign:2.1.0"
     CDS             103..756
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /codon_start=1
                     /product="GRB2-related adapter protein"
                     /protein_id="NP_001264482.2"
                     /db_xref="CGNC:50277"
                     /db_xref="GeneID:416523"
                     /translation="
MESVALYNFQTTEKDELPFQKGDTLKILNMEDDQNWYKAELYGCEGFVPKNYIKVKPHPWYAGRISRHVAEELLLKRRYVGAFLIRESESAPGEFSISVNYGQHVQHFKVLRERNGKYFLWEEKFNSLNELVDFYRTTTIAKKQQIFLRDDEQSPEVKRPKFVQAQFDFSAHDSSQLPFYRGDIIEVLDCPDPNWWQGKIYGRIGFFPRNYVHPIRK"
     misc_feature    106..267
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="N-terminal Src homology 3 domain of GRB2-related
                     adaptor protein; Region: SH3_GRAP_N; cd11948"
                     /db_xref="CDD:212881"
     misc_feature    order(118..129,136..141,148..150,205..210,247..258)
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212881"
     misc_feature    268..552
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="Src homology 2 domain found in Growth factor
                     receptor-bound protein 2 (Grb2) and similar proteins;
                     Region: SH2_Grb2_like; cd09941"
                     /db_xref="CDD:199828"
     misc_feature    order(301..303,358..360,364..366,388..390,421..423,
                     427..429)
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="phosphotyrosine binding pocket [polypeptide
                     binding]; other site"
                     /db_xref="CDD:199828"
     misc_feature    586..744
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="C-terminal Src homology 3 domain of GRB2-related
                     adaptor protein; Region: SH3_GRAP_C; cd11951"
                     /db_xref="CDD:212884"
     misc_feature    order(601..603,607..609,616..621,628..630,682..687,
                     718..720,724..726,730..735)
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212884"
     exon            181..278
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /inference="alignment:Splign:2.1.0"
     exon            279..401
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /inference="alignment:Splign:2.1.0"
     exon            402..570
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /inference="alignment:Splign:2.1.0"
     exon            571..1178
                     /gene="GRAPL"
                     /gene_synonym="GRAP"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gacatcagcgcggcttcctgcctgccggcagcacccgccccgggccccacagccccgtgccgtggggcagcgagccccagggccccgctcgtgccctgcagcatggagtcggtggctctgtacaacttccagacaacggagaaggatgagctgcccttccagaaaggggacaccttgaagatcctcaacatggaagatgaccagaactggtacaaggctgagctgtatggctgcgagggctttgtccccaaaaactacatcaaagtcaaaccccacccgtggtatgcagggaggatctcccggcacgtggcagaggagctgctcctcaagcgcagatatgtgggagccttcctgatccgtgagagcgagagcgcgccgggggagttctccatctccgtcaactacgggcagcacgtccagcacttcaaggtgctccgtgagcgcaatggcaaatatttcctctgggaggagaagttcaactccctcaatgagctggtggacttctacaggaccaccaccatcgccaagaagcagcagatcttccttcgggatgacgagcagagcccagaggtgaaaagacccaaattcgtgcaagcccagttcgacttctctgcccatgacagctcccagctgcccttctaccgcggggacatcatcgaggtgctggactgccccgaccccaactggtggcagggaaagatctatggacgcattggcttcttcccccgcaattatgtccaccccatccgcaagtgagccgccgctgccgccccgcttcgcgcatcccccatccccacgctgtccccatgggctgcagatcccggcagtgccatctgtggatgctgtgctggaggcagatgctgccccgctcccagcaccaacaaatacccacgtgaagaagcagagggctgcgtgacattgaggggtatccaaacttttgtggagtcacgatgggtggcagctcctggccaggacctctccagccccagctccaggaaggctgcagtcagctgggacgtggctgggctcagggatgctgcagagcagttctggggcatggggtgctggaagggctgctcaggaggaattcggtcctgctggtgccatttgtagctgcaaattgtggctttttcattttttatttttatctagagttagtaaagtgtgttgggattaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]