ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-05 01:02:55, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001277553 1178 bp mRNA linear VRT 23-SEP-2023
DEFINITION Gallus gallus GRB2 related adaptor protein like (GRAPL), mRNA.
ACCESSION NM_001277553 XM_003642116 XM_414827
VERSION NM_001277553.2
KEYWORDS RefSeq.
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
REFERENCE 1 (bases 1 to 1178)
AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
TITLE Manual GO annotation of predictive protein signatures: the InterPro
approach to GO curation
JOURNAL Database (Oxford) 2012, bar068 (2012)
PUBMED 22301074
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1178)
AUTHORS Abdrakhmanov I, Lodygin D, Geroth P, Arakawa H, Law A, Plachy J,
Korn B and Buerstedde JM.
TITLE A large database of chicken bursal ESTs as a resource for the
analysis of vertebrate gene function
JOURNAL Genome Res 10 (12), 2062-2069 (2000)
PUBMED 11116100
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAENSK010000257.1.
On Sep 23, 2021 this sequence version replaced NM_001277553.1.
##Evidence-Data-START##
Transcript exon combination :: BX931837.2, HAEK01072420.1
[ECO:0000332]
RNAseq introns :: mixed sample support SAMEA103992290,
SAMEA103992323 [ECO:0006172]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-180 JAENSK010000257.1 5175338-5175517 c
181-278 JAENSK010000257.1 5174273-5174370 c
279-401 JAENSK010000257.1 5173189-5173311 c
402-570 JAENSK010000257.1 5172300-5172468 c
571-1178 JAENSK010000257.1 5171474-5172081 c
FEATURES Location/Qualifiers
source 1..1178
/organism="Gallus gallus"
/mol_type="mRNA"
/db_xref="taxon:9031"
/chromosome="14"
/map="14"
gene 1..1178
/gene="GRAPL"
/gene_synonym="GRAP"
/note="GRB2 related adaptor protein like"
/db_xref="CGNC:50277"
/db_xref="GeneID:416523"
exon 1..180
/gene="GRAPL"
/gene_synonym="GRAP"
/inference="alignment:Splign:2.1.0"
CDS 103..756
/gene="GRAPL"
/gene_synonym="GRAP"
/codon_start=1
/product="GRB2-related adapter protein"
/protein_id="NP_001264482.2"
/db_xref="CGNC:50277"
/db_xref="GeneID:416523"
/translation="
MESVALYNFQTTEKDELPFQKGDTLKILNMEDDQNWYKAELYGCEGFVPKNYIKVKPHPWYAGRISRHVAEELLLKRRYVGAFLIRESESAPGEFSISVNYGQHVQHFKVLRERNGKYFLWEEKFNSLNELVDFYRTTTIAKKQQIFLRDDEQSPEVKRPKFVQAQFDFSAHDSSQLPFYRGDIIEVLDCPDPNWWQGKIYGRIGFFPRNYVHPIRK"
misc_feature 106..267
/gene="GRAPL"
/gene_synonym="GRAP"
/note="N-terminal Src homology 3 domain of GRB2-related
adaptor protein; Region: SH3_GRAP_N; cd11948"
/db_xref="CDD:212881"
misc_feature order(118..129,136..141,148..150,205..210,247..258)
/gene="GRAPL"
/gene_synonym="GRAP"
/note="peptide ligand binding site [polypeptide binding];
other site"
/db_xref="CDD:212881"
misc_feature 268..552
/gene="GRAPL"
/gene_synonym="GRAP"
/note="Src homology 2 domain found in Growth factor
receptor-bound protein 2 (Grb2) and similar proteins;
Region: SH2_Grb2_like; cd09941"
/db_xref="CDD:199828"
misc_feature order(301..303,358..360,364..366,388..390,421..423,
427..429)
/gene="GRAPL"
/gene_synonym="GRAP"
/note="phosphotyrosine binding pocket [polypeptide
binding]; other site"
/db_xref="CDD:199828"
misc_feature 586..744
/gene="GRAPL"
/gene_synonym="GRAP"
/note="C-terminal Src homology 3 domain of GRB2-related
adaptor protein; Region: SH3_GRAP_C; cd11951"
/db_xref="CDD:212884"
misc_feature order(601..603,607..609,616..621,628..630,682..687,
718..720,724..726,730..735)
/gene="GRAPL"
/gene_synonym="GRAP"
/note="peptide ligand binding site [polypeptide binding];
other site"
/db_xref="CDD:212884"
exon 181..278
/gene="GRAPL"
/gene_synonym="GRAP"
/inference="alignment:Splign:2.1.0"
exon 279..401
/gene="GRAPL"
/gene_synonym="GRAP"
/inference="alignment:Splign:2.1.0"
exon 402..570
/gene="GRAPL"
/gene_synonym="GRAP"
/inference="alignment:Splign:2.1.0"
exon 571..1178
/gene="GRAPL"
/gene_synonym="GRAP"
/inference="alignment:Splign:2.1.0"
ORIGIN
gacatcagcgcggcttcctgcctgccggcagcacccgccccgggccccacagccccgtgccgtggggcagcgagccccagggccccgctcgtgccctgcagcatggagtcggtggctctgtacaacttccagacaacggagaaggatgagctgcccttccagaaaggggacaccttgaagatcctcaacatggaagatgaccagaactggtacaaggctgagctgtatggctgcgagggctttgtccccaaaaactacatcaaagtcaaaccccacccgtggtatgcagggaggatctcccggcacgtggcagaggagctgctcctcaagcgcagatatgtgggagccttcctgatccgtgagagcgagagcgcgccgggggagttctccatctccgtcaactacgggcagcacgtccagcacttcaaggtgctccgtgagcgcaatggcaaatatttcctctgggaggagaagttcaactccctcaatgagctggtggacttctacaggaccaccaccatcgccaagaagcagcagatcttccttcgggatgacgagcagagcccagaggtgaaaagacccaaattcgtgcaagcccagttcgacttctctgcccatgacagctcccagctgcccttctaccgcggggacatcatcgaggtgctggactgccccgaccccaactggtggcagggaaagatctatggacgcattggcttcttcccccgcaattatgtccaccccatccgcaagtgagccgccgctgccgccccgcttcgcgcatcccccatccccacgctgtccccatgggctgcagatcccggcagtgccatctgtggatgctgtgctggaggcagatgctgccccgctcccagcaccaacaaatacccacgtgaagaagcagagggctgcgtgacattgaggggtatccaaacttttgtggagtcacgatgggtggcagctcctggccaggacctctccagccccagctccaggaaggctgcagtcagctgggacgtggctgggctcagggatgctgcagagcagttctggggcatggggtgctggaagggctgctcaggaggaattcggtcctgctggtgccatttgtagctgcaaattgtggctttttcattttttatttttatctagagttagtaaagtgtgttgggattaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]