GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-02 10:46:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001276324            1923 bp    mRNA    linear   VRT 05-DEC-2024
DEFINITION  Gallus gallus endoplasmic reticulum protein 29 (ERP29), mRNA.
ACCESSION   NM_001276324 XM_415173
VERSION     NM_001276324.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1923)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1923)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1923)
  AUTHORS   Mkrtchian,S. and Sandalova,T.
  TITLE     ERp29, an unusual redox-inactive member of the thioredoxin family
  JOURNAL   Antioxid Redox Signal 8 (3-4), 325-337 (2006)
   PUBMED   16677078
  REMARK    Review article
REFERENCE   4  (bases 1 to 1923)
  AUTHORS   Caldwell,R.B., Kierzek,A.M., Arakawa,H., Bezzubov,Y., Zaim,J.,
            Fiedler,P., Kutter,S., Blagodatski,A., Kostovska,D., Koter,M.,
            Plachy,J., Carninci,P., Hayashizaki,Y. and Buerstedde,J.M.
  TITLE     Full-length cDNAs from chicken bursal lymphocytes to facilitate
            gene function analysis
  JOURNAL   Genome Biol 6 (1), R6 (2005)
   PUBMED   15642098
REFERENCE   5  (bases 1 to 1923)
  AUTHORS   Boardman,P.E., Sanz-Ezquerro,J., Overton,I.M., Burt,D.W., Bosch,E.,
            Fong,W.T., Tickle,C., Brown,W.R., Wilson,S.A. and Hubbard,S.J.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
REFERENCE   6  (bases 1 to 1923)
  AUTHORS   Abdrakhmanov,I., Lodygin,D., Geroth,P., Arakawa,H., Law,A.,
            Plachy,J., Korn,B. and Buerstedde,J.M.
  TITLE     A large database of chicken bursal ESTs as a resource for the
            analysis of vertebrate gene function
  JOURNAL   Genome Res 10 (12), 2062-2069 (2000)
   PUBMED   11116100
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AJ720735.1, BU401484.1, AJ397785.1, BU350207.1, BU139356.1 and
            CK607880.1.
            
            On Feb 2, 2013 this sequence version replaced XM_415173.3.
            
            Sequence Note: This RefSeq record was created from transcript data
            from different strains because no single transcript from the same
            strain was available for the full length of the gene. The extent of
            this transcript is supported by transcript alignments and
            orthologous data.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ720735.1, BU369995.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992432, SAMEA103992533
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-364               AJ720735.1         2-365
            365-705             BU401484.1         337-677
            706-997             AJ397785.1         373-664
            998-1464            BU350207.1         13-479
            1465-1711           BU139356.1         245-491
            1712-1923           CK607880.1         1-212               c
FEATURES             Location/Qualifiers
     source          1..1923
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="15"
                     /map="15"
                     /breed="Leghorn"
     gene            1..1923
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /note="endoplasmic reticulum protein 29"
                     /db_xref="CGNC:50366"
                     /db_xref="GeneID:416882"
     exon            1..143
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /inference="alignment:Splign:2.1.0"
     CDS             27..785
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /note="endoplasmic reticulum resident protein 29"
                     /codon_start=1
                     /product="endoplasmic reticulum resident protein 29
                     precursor"
                     /protein_id="NP_001263253.1"
                     /db_xref="CGNC:50366"
                     /db_xref="GeneID:416882"
                     /translation="
MAAAAAAGSLLLCLLGLALPGSALHTKGSVPLDTITFYKVIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKYKLDKEKYPIFYLFQDGDFDNPLPYSGHIKAGAIQRWLKSNGIYLGMPGCLKEYDVLASKFMSVTDKSERQSLLKKGQQSLEKAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKLIEKNKMSDGKKEELQKSLNILASFLKKNNEKDEL"
     sig_peptide     27..95
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    105..446
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /note="PDIa family, endoplasmic reticulum protein 29
                     (ERp29) subfamily; ERp29 is a ubiquitous ER-resident
                     protein expressed in high levels in secretory cells. It
                     forms homodimers and higher oligomers in vitro and in
                     vivo. It contains a redox inactive TRX-like...; Region:
                     PDI_a_ERp29_N; cd03007"
                     /db_xref="CDD:239305"
     misc_feature    order(105..110,114..116,123..125,129..131,153..155,
                     159..161,246..254)
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239305"
     misc_feature    465..752
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /note="Endoplasmic reticulum protein ERp29, C-terminal
                     domain; Region: ERp29; pfam07749"
                     /db_xref="CDD:462253"
     exon            144..282
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /inference="alignment:Splign:2.1.0"
     exon            283..1916
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1895..1900
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
     polyA_site      1916
                     /gene="ERP29"
                     /gene_synonym="C12orf8"
ORIGIN      
cagccccactccctccgcgctccgccatggctgcggcggccgctgccggctcgctgctcctctgcttgctcggcttggcgctgcccggcagcgcgctgcacaccaagggctccgtgcccctcgacaccatcaccttttacaaggtgatcccaaagcataagtttgtccttgtgaagtttgatacgcagtacccttacggcgagaaacaagatgagttcaaaaagctggcagagagctcaggctccagtgaagatcttctggtggctgaagtgggaatatcagactatggtgataaactgaacactgagctgggagaaaagtacaagctggacaaggagaagtaccctatcttttatttgttccaggatggtgactttgacaatcccttaccttactctggccacattaaagccggggctattcagcgctggctgaagagtaatggcatctacctggggatgccgggctgtctgaaggagtatgatgtgctggccagcaagtttatgagtgtcactgacaagtcagaacgccagtccctcctgaagaaggggcagcagagcttagagaaagcaaaggagactgagaagaagtcagctgagcaatacttgaaaattatgagcaagatactggagcagggagaagagtttgctgctaacgaagttgtccgaatcacaaaactgattgagaagaacaaaatgagtgatggaaaaaaggaggagctccagaaaagcctcaatatcctcgcttctttcctaaagaagaataatgaaaaagatgagctctgatactctggggaactttgtgcaagctgtgaaacactgtcaagtcctaaccagttctcccagtgcaagcaaacttcccgctgacttcaagagagcagcagacgcccttgtatcctcagttataagatcaagaggaagcaatgcctcaaaaacacagtattctacgtgttgggaaaaacaccttaaagcaagctgccagtattgtgaaatactattaagtaacagtgttaaagtagaccaaaaaaatcactatgttggcctggagcacattcccggcagtttttacagctgttccctggcaaaccaatgacaaaattcagtctcacattccgtgtttccaaaggtacagaggtggtgcccctgccatgcccgcctgcccctggttttagtgctcttgggtttagttctgttcacccctcatcccaccctctttctccccggtagggttttctctgagtcctgtccttacctgctgctgctgctgaccgagagctgccgtttccttctgccttttccagcagttgttgggctggggttcaatctgcacatgagagcctgtcctgctgcagcagaacccctttgtggtacccggcagagcgaggtctgagtgctgaggtctcctccagcggcagttacactggggctcacccatttgtgcaaaaatgtgcttttttttccagtggcagattaaattcaggtgagttttcctatggctgaaggcacccgatgcttttttgacctgttcttcctgtccaaacttcacctcatgaataagagcaggaggcagaaagggacatttaaaagttccgagtggttgctaacatgaagaaaatgctttctcccagcctgatcttcagaatgacactgtgaaactaaagcttcagcagccctcggcagagttaaaactatttaaaaacgaggtcttgcgacaggaagaaaaagcgttaattcccttaaaagctctgtcagggtcacaaacaccttcacgtttcaccttgagactgtgctttctgctaagcaaattgatttctgtgggagctttgctgccttttgaatcctggggtggggatgaagagctgccagacgaaatgtattaatattgctctgatgataataaaaactggttccaacgaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]