ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-23 15:00:01, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001276324 1923 bp mRNA linear VRT 23-JUN-2025
DEFINITION Gallus gallus endoplasmic reticulum protein 29 (ERP29), mRNA.
ACCESSION NM_001276324 XM_415173
VERSION NM_001276324.1
KEYWORDS RefSeq.
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
REFERENCE 1 (bases 1 to 1923)
AUTHORS Tang,H., Finn,R.D. and Thomas,P.D.
TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with
Gene Ontology terms and other annotations
JOURNAL Bioinformatics 35 (3), 518-520 (2019)
PUBMED 30032202
REFERENCE 2 (bases 1 to 1923)
AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
TITLE Manual GO annotation of predictive protein signatures: the InterPro
approach to GO curation
JOURNAL Database (Oxford) 2012, bar068 (2012)
PUBMED 22301074
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1923)
AUTHORS Mkrtchian,S. and Sandalova,T.
TITLE ERp29, an unusual redox-inactive member of the thioredoxin family
JOURNAL Antioxid Redox Signal 8 (3-4), 325-337 (2006)
PUBMED 16677078
REMARK Review article
REFERENCE 4 (bases 1 to 1923)
AUTHORS Caldwell,R.B., Kierzek,A.M., Arakawa,H., Bezzubov,Y., Zaim,J.,
Fiedler,P., Kutter,S., Blagodatski,A., Kostovska,D., Koter,M.,
Plachy,J., Carninci,P., Hayashizaki,Y. and Buerstedde,J.M.
TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
gene function analysis
JOURNAL Genome Biol 6 (1), R6 (2005)
PUBMED 15642098
REFERENCE 5 (bases 1 to 1923)
AUTHORS Boardman,P.E., Sanz-Ezquerro,J., Overton,I.M., Burt,D.W., Bosch,E.,
Fong,W.T., Tickle,C., Brown,W.R., Wilson,S.A. and Hubbard,S.J.
TITLE A comprehensive collection of chicken cDNAs
JOURNAL Curr Biol 12 (22), 1965-1969 (2002)
PUBMED 12445392
REFERENCE 6 (bases 1 to 1923)
AUTHORS Abdrakhmanov,I., Lodygin,D., Geroth,P., Arakawa,H., Law,A.,
Plachy,J., Korn,B. and Buerstedde,J.M.
TITLE A large database of chicken bursal ESTs as a resource for the
analysis of vertebrate gene function
JOURNAL Genome Res 10 (12), 2062-2069 (2000)
PUBMED 11116100
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AJ720735.1, BU401484.1, AJ397785.1, BU350207.1, BU139356.1 and
CK607880.1.
On Feb 2, 2013 this sequence version replaced XM_415173.3.
Sequence Note: This RefSeq record was created from transcript data
from different strains because no single transcript from the same
strain was available for the full length of the gene. The extent of
this transcript is supported by transcript alignments and
orthologous data.
##Evidence-Data-START##
Transcript exon combination :: AJ720735.1, BU369995.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA103992432, SAMEA103992533
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-364 AJ720735.1 2-365
365-705 BU401484.1 337-677
706-997 AJ397785.1 373-664
998-1464 BU350207.1 13-479
1465-1711 BU139356.1 245-491
1712-1923 CK607880.1 1-212 c
FEATURES Location/Qualifiers
source 1..1923
/organism="Gallus gallus"
/mol_type="mRNA"
/db_xref="taxon:9031"
/chromosome="15"
/map="15"
/breed="Leghorn"
gene 1..1923
/gene="ERP29"
/gene_synonym="C12orf8"
/note="endoplasmic reticulum protein 29"
/db_xref="CGNC:50366"
/db_xref="GeneID:416882"
exon 1..143
/gene="ERP29"
/gene_synonym="C12orf8"
/inference="alignment:Splign:2.1.0"
CDS 27..785
/gene="ERP29"
/gene_synonym="C12orf8"
/note="endoplasmic reticulum resident protein 29"
/codon_start=1
/product="endoplasmic reticulum resident protein 29
precursor"
/protein_id="NP_001263253.1"
/db_xref="CGNC:50366"
/db_xref="GeneID:416882"
/translation="
MAAAAAAGSLLLCLLGLALPGSALHTKGSVPLDTITFYKVIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKYKLDKEKYPIFYLFQDGDFDNPLPYSGHIKAGAIQRWLKSNGIYLGMPGCLKEYDVLASKFMSVTDKSERQSLLKKGQQSLEKAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKLIEKNKMSDGKKEELQKSLNILASFLKKNNEKDEL"
sig_peptide 27..95
/gene="ERP29"
/gene_synonym="C12orf8"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
misc_feature 105..446
/gene="ERP29"
/gene_synonym="C12orf8"
/note="PDIa family, endoplasmic reticulum protein 29
(ERp29) subfamily; ERp29 is a ubiquitous ER-resident
protein expressed in high levels in secretory cells. It
forms homodimers and higher oligomers in vitro and in
vivo. It contains a redox inactive TRX-like...; Region:
PDI_a_ERp29_N; cd03007"
/db_xref="CDD:239305"
misc_feature order(105..110,114..116,123..125,129..131,153..155,
159..161,246..254)
/gene="ERP29"
/gene_synonym="C12orf8"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:239305"
misc_feature 465..752
/gene="ERP29"
/gene_synonym="C12orf8"
/note="Endoplasmic reticulum protein ERp29, C-terminal
domain; Region: ERp29; pfam07749"
/db_xref="CDD:462253"
exon 144..282
/gene="ERP29"
/gene_synonym="C12orf8"
/inference="alignment:Splign:2.1.0"
exon 283..1916
/gene="ERP29"
/gene_synonym="C12orf8"
/inference="alignment:Splign:2.1.0"
regulatory 1895..1900
/regulatory_class="polyA_signal_sequence"
/gene="ERP29"
/gene_synonym="C12orf8"
polyA_site 1916
/gene="ERP29"
/gene_synonym="C12orf8"
ORIGIN
cagccccactccctccgcgctccgccatggctgcggcggccgctgccggctcgctgctcctctgcttgctcggcttggcgctgcccggcagcgcgctgcacaccaagggctccgtgcccctcgacaccatcaccttttacaaggtgatcccaaagcataagtttgtccttgtgaagtttgatacgcagtacccttacggcgagaaacaagatgagttcaaaaagctggcagagagctcaggctccagtgaagatcttctggtggctgaagtgggaatatcagactatggtgataaactgaacactgagctgggagaaaagtacaagctggacaaggagaagtaccctatcttttatttgttccaggatggtgactttgacaatcccttaccttactctggccacattaaagccggggctattcagcgctggctgaagagtaatggcatctacctggggatgccgggctgtctgaaggagtatgatgtgctggccagcaagtttatgagtgtcactgacaagtcagaacgccagtccctcctgaagaaggggcagcagagcttagagaaagcaaaggagactgagaagaagtcagctgagcaatacttgaaaattatgagcaagatactggagcagggagaagagtttgctgctaacgaagttgtccgaatcacaaaactgattgagaagaacaaaatgagtgatggaaaaaaggaggagctccagaaaagcctcaatatcctcgcttctttcctaaagaagaataatgaaaaagatgagctctgatactctggggaactttgtgcaagctgtgaaacactgtcaagtcctaaccagttctcccagtgcaagcaaacttcccgctgacttcaagagagcagcagacgcccttgtatcctcagttataagatcaagaggaagcaatgcctcaaaaacacagtattctacgtgttgggaaaaacaccttaaagcaagctgccagtattgtgaaatactattaagtaacagtgttaaagtagaccaaaaaaatcactatgttggcctggagcacattcccggcagtttttacagctgttccctggcaaaccaatgacaaaattcagtctcacattccgtgtttccaaaggtacagaggtggtgcccctgccatgcccgcctgcccctggttttagtgctcttgggtttagttctgttcacccctcatcccaccctctttctccccggtagggttttctctgagtcctgtccttacctgctgctgctgctgaccgagagctgccgtttccttctgccttttccagcagttgttgggctggggttcaatctgcacatgagagcctgtcctgctgcagcagaacccctttgtggtacccggcagagcgaggtctgagtgctgaggtctcctccagcggcagttacactggggctcacccatttgtgcaaaaatgtgcttttttttccagtggcagattaaattcaggtgagttttcctatggctgaaggcacccgatgcttttttgacctgttcttcctgtccaaacttcacctcatgaataagagcaggaggcagaaagggacatttaaaagttccgagtggttgctaacatgaagaaaatgctttctcccagcctgatcttcagaatgacactgtgaaactaaagcttcagcagccctcggcagagttaaaactatttaaaaacgaggtcttgcgacaggaagaaaaagcgttaattcccttaaaagctctgtcagggtcacaaacaccttcacgtttcaccttgagactgtgctttctgctaagcaaattgatttctgtgggagctttgctgccttttgaatcctggggtggggatgaagagctgccagacgaaatgtattaatattgctctgatgataataaaaactggttccaacgaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]