GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-01 07:47:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001257333             742 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus ribosomal protein L9 (RPL9), mRNA.
ACCESSION   NM_001257333 XM_003641246
VERSION     NM_001257333.3
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 742)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 742)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 742)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000074.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001257333.2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data from different strains because no single
            transcript from the same strain was available for the full length
            of the gene. The extent of this transcript is supported by
            transcript alignments and orthologous data.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CF251699.1, BU144270.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-27                JAENSK010000074.1  21839287-21839313
            28-74               JAENSK010000074.1  21839726-21839772
            75-190              JAENSK010000074.1  21839855-21839970
            191-286             JAENSK010000074.1  21840843-21840938
            287-419             JAENSK010000074.1  21841248-21841380
            420-500             JAENSK010000074.1  21843358-21843438
            501-619             JAENSK010000074.1  21843729-21843847
            620-742             JAENSK010000074.1  21845018-21845140
FEATURES             Location/Qualifiers
     source          1..742
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="4"
                     /map="4"
     gene            1..742
                     /gene="RPL9"
                     /note="ribosomal protein L9"
                     /db_xref="CGNC:52467"
                     /db_xref="GeneID:425468"
     exon            1..27
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     exon            28..74
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     CDS             29..607
                     /gene="RPL9"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL6"
                     /protein_id="NP_001244262.1"
                     /db_xref="CGNC:52467"
                     /db_xref="GeneID:425468"
                     /translation="
MKTILSNQTVDIPEQVSVSLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKRRKLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQDNGSLVEIRNFLGEKYIRRVRMRPGVSCAVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"
     misc_feature    29..601
                     /gene="RPL9"
                     /note="60S ribosomal protein L6; Provisional; Region:
                     PTZ00027"
                     /db_xref="CDD:240234"
     exon            75..190
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     exon            191..286
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     exon            287..419
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     exon            420..500
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     exon            501..619
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
     exon            620..742
                     /gene="RPL9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcccctttcggcgctgcctgctgccagaatgaagaccatcctcagcaaccagaccgtggacatccctgagcaagtcagcgtgtccctgaagggccgcacggtcatcgtgaagggcccccggggaaccctgcggagagacttcaaccacatcaacgtggagctgtccctcttggggaagaagcgcaggaagctgcgtgttgacaagtggtggggtaacagaaaggagctggccacggtccgcacaatttgcagccatgtacagaacatgataaagggcgttacgctgggcttccgttataagatgaggtcggtgtacgctcacttcccaatcaatgtagtcatacaggataacggctcacttgtggaaatccgaaactttttgggagagaagtacattcgcagggtgcgcatgaggccaggtgtttcctgtgctgtttctcaagcccagaaagatgagctgatccttgaagggaatgacattgaattggtctccaattcagctgccttgatccagcaagccactacagtcaagaataaggatatcaggaaattcttggacggtatctacgtctccgagaaaggaacagtacagcaggcagatgagtagaactcttactagttgtctgggtcctgaaaaacaaaacaaaaaatgagacggcatatcagcacgtaatggattgggacatctgatgcaaaaaactgaacaagatcagaggtttaataaaataaaacatatttcata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]