ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-14 13:48:24, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001257333 742 bp mRNA linear VRT 23-SEP-2023
DEFINITION Gallus gallus ribosomal protein L9 (RPL9), mRNA.
ACCESSION NM_001257333 XM_003641246
VERSION NM_001257333.3
KEYWORDS RefSeq.
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
REFERENCE 1 (bases 1 to 742)
AUTHORS Tang H, Finn RD and Thomas PD.
TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with
Gene Ontology terms and other annotations
JOURNAL Bioinformatics 35 (3), 518-520 (2019)
PUBMED 30032202
REFERENCE 2 (bases 1 to 742)
AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
TITLE Manual GO annotation of predictive protein signatures: the InterPro
approach to GO curation
JOURNAL Database (Oxford) 2012, bar068 (2012)
PUBMED 22301074
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 742)
AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
TITLE A comprehensive collection of chicken cDNAs
JOURNAL Curr Biol 12 (22), 1965-1969 (2002)
PUBMED 12445392
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAENSK010000074.1.
On Sep 23, 2021 this sequence version replaced NM_001257333.2.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data from different strains because no single
transcript from the same strain was available for the full length
of the gene. The extent of this transcript is supported by
transcript alignments and orthologous data.
##Evidence-Data-START##
Transcript exon combination :: CF251699.1, BU144270.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA103992290, SAMEA103992323
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-27 JAENSK010000074.1 21839287-21839313
28-74 JAENSK010000074.1 21839726-21839772
75-190 JAENSK010000074.1 21839855-21839970
191-286 JAENSK010000074.1 21840843-21840938
287-419 JAENSK010000074.1 21841248-21841380
420-500 JAENSK010000074.1 21843358-21843438
501-619 JAENSK010000074.1 21843729-21843847
620-742 JAENSK010000074.1 21845018-21845140
FEATURES Location/Qualifiers
source 1..742
/organism="Gallus gallus"
/mol_type="mRNA"
/db_xref="taxon:9031"
/chromosome="4"
/map="4"
gene 1..742
/gene="RPL9"
/note="ribosomal protein L9"
/db_xref="CGNC:52467"
/db_xref="GeneID:425468"
exon 1..27
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
exon 28..74
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
CDS 29..607
/gene="RPL9"
/codon_start=1
/product="large ribosomal subunit protein uL6"
/protein_id="NP_001244262.1"
/db_xref="CGNC:52467"
/db_xref="GeneID:425468"
/translation="
MKTILSNQTVDIPEQVSVSLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKRRKLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQDNGSLVEIRNFLGEKYIRRVRMRPGVSCAVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"
misc_feature 29..601
/gene="RPL9"
/note="60S ribosomal protein L6; Provisional; Region:
PTZ00027"
/db_xref="CDD:240234"
exon 75..190
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
exon 191..286
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
exon 287..419
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
exon 420..500
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
exon 501..619
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
exon 620..742
/gene="RPL9"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcccctttcggcgctgcctgctgccagaatgaagaccatcctcagcaaccagaccgtggacatccctgagcaagtcagcgtgtccctgaagggccgcacggtcatcgtgaagggcccccggggaaccctgcggagagacttcaaccacatcaacgtggagctgtccctcttggggaagaagcgcaggaagctgcgtgttgacaagtggtggggtaacagaaaggagctggccacggtccgcacaatttgcagccatgtacagaacatgataaagggcgttacgctgggcttccgttataagatgaggtcggtgtacgctcacttcccaatcaatgtagtcatacaggataacggctcacttgtggaaatccgaaactttttgggagagaagtacattcgcagggtgcgcatgaggccaggtgtttcctgtgctgtttctcaagcccagaaagatgagctgatccttgaagggaatgacattgaattggtctccaattcagctgccttgatccagcaagccactacagtcaagaataaggatatcaggaaattcttggacggtatctacgtctccgagaaaggaacagtacagcaggcagatgagtagaactcttactagttgtctgggtcctgaaaaacaaaacaaaaaatgagacggcatatcagcacgtaatggattgggacatctgatgcaaaaaactgaacaagatcagaggtttaataaaataaaacatatttcata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]