GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-26 17:27:24, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001252160            1073 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus trafficking protein particle complex 6A (TRAPPC6A),
            mRNA.
ACCESSION   NM_001252160
VERSION     NM_001252160.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1073)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1073)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1073)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BU398441.1,
            BX935910.2, BX932692.1 and BX275471.3.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript from the same
            strain was available for the full length of the gene. The extent of
            this transcript is supported by transcript alignments and
            orthologous data.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX932658.1, BX935910.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992415, SAMEA103992437
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-54                BU398441.1         1-54
            55-441              BX935910.2         1-387
            442-685             BX932692.1         546-789
            686-1073            BX275471.3         415-802
FEATURES             Location/Qualifiers
     source          1..1073
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="5"
                     /map="5"
                     /breed="Leghorn"
     gene            1..1073
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /note="trafficking protein particle complex 6A"
                     /db_xref="CGNC:7721"
                     /db_xref="GeneID:423337"
     exon            1..150
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /inference="alignment:Splign:2.1.0"
     CDS             70..546
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /note="trafficking protein particle complex 6B"
                     /codon_start=1
                     /product="trafficking protein particle complex subunit 6B"
                     /protein_id="NP_001239089.1"
                     /db_xref="CGNC:7721"
                     /db_xref="GeneID:423337"
                     /translation="
MADEALFLLLHNEMVAGLYRAAEQGEGENGRCTTKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHAPKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKM"
     misc_feature    76..537
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /note="Trs33 subunit of the TRAPP complex; Region:
                     TRAPPC6A_Trs33; cd14944"
                     /db_xref="CDD:271347"
     misc_feature    order(82..84,91..93,103..105,376..381,409..411,421..423)
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /note="synbindin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271347"
     misc_feature    order(85..90,94..102,106..111,118..120,172..174,184..186,
                     193..198,205..210,217..219,292..294,301..303,361..363,
                     430..432)
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /note="BET3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:271347"
     exon            151..218
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /inference="alignment:Splign:2.1.0"
     exon            219..336
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /inference="alignment:Splign:2.1.0"
     exon            337..420
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /inference="alignment:Splign:2.1.0"
     exon            421..514
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /inference="alignment:Splign:2.1.0"
     exon            515..1073
                     /gene="TRAPPC6A"
                     /gene_synonym="TRAPPC6B"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggctcccggcggcggcgggccgttgccgtgacggcgggggggcggggggacgcccgcagcgcagcggacatggcggacgaggcgctgttcctgctgctgcacaacgagatggtggcggggctgtaccgcgccgccgagcagggcgaaggggagaacggccgctgcaccaccaagctggagagcatgggcttccgcgtcgggcaggggctgatcgaaaggtttacaaaagatacagccaggttcaaggatgaattagatattatgaagttcatttgcaaagatttttggacaactgtattcaaaaaacaaatagacaacctaaggactaatcatcagggtatttatgttcttcaagacaacaaatttcgactcttgacacaaatgtctgcaggaaagcagtatttagaacatgcaccaaagtatttagcatttacctgtggactaatcagagggggcctatcgaatttgggaataaagagtattgtaacagctgaagtttcatcaatgcctgcatgtaaattccaggtgatgatacagaaaatgtagagcacgttcagatctgggtatccaccttaaacatcctttgtctgtggttttggaatcatggttcagctttgtatatagcatgtaaattatagcactgtgcagcacaattccaaagtatataataaatgtttgttaaaataacactgttctcctatcttggtatgaaattaattctatacaaaggtattaatgtccgtcatggtaaaaactgtcttctcaaaagttaccaacaaaagatttatagtactaaatcaaacaataggtagattttaagaacagagtaaggtcacaacgaagactcagttggtataaggaacaaatgtgttttgtgtcacctaagaaatgccaaactgctgcccttccataaccattccttacagtgaggcagcaactttctattattctgaggaagaaattattgcataactcaacagtcttaattaacagcattcagtggaatatagaactgatatgagcagataaagataacttatttctacaaaaataaaggtatatcctatgcctct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]