2025-09-18 10:41:53, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001252160 1073 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus trafficking protein particle complex 6A (TRAPPC6A), mRNA. ACCESSION NM_001252160 VERSION NM_001252160.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1073) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1073) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1073) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BU398441.1, BX935910.2, BX932692.1 and BX275471.3. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript from the same strain was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. ##Evidence-Data-START## Transcript exon combination :: BX932658.1, BX935910.2 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992415, SAMEA103992437 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-54 BU398441.1 1-54 55-441 BX935910.2 1-387 442-685 BX932692.1 546-789 686-1073 BX275471.3 415-802 FEATURES Location/Qualifiers source 1..1073 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="5" /map="5" /breed="Leghorn" gene 1..1073 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /note="trafficking protein particle complex 6A" /db_xref="CGNC:7721" /db_xref="GeneID:423337" exon 1..150 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /inference="alignment:Splign:2.1.0" CDS 70..546 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /note="trafficking protein particle complex 6B" /codon_start=1 /product="trafficking protein particle complex subunit 6B" /protein_id="NP_001239089.1" /db_xref="CGNC:7721" /db_xref="GeneID:423337" /translation="
MADEALFLLLHNEMVAGLYRAAEQGEGENGRCTTKLESMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHAPKYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKM"
misc_feature 76..537 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /note="Trs33 subunit of the TRAPP complex; Region: TRAPPC6A_Trs33; cd14944" /db_xref="CDD:271347" misc_feature order(82..84,91..93,103..105,376..381,409..411,421..423) /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /note="synbindin interface [polypeptide binding]; other site" /db_xref="CDD:271347" misc_feature order(85..90,94..102,106..111,118..120,172..174,184..186, 193..198,205..210,217..219,292..294,301..303,361..363, 430..432) /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /note="BET3 interface [polypeptide binding]; other site" /db_xref="CDD:271347" exon 151..218 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /inference="alignment:Splign:2.1.0" exon 219..336 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /inference="alignment:Splign:2.1.0" exon 337..420 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /inference="alignment:Splign:2.1.0" exon 421..514 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /inference="alignment:Splign:2.1.0" exon 515..1073 /gene="TRAPPC6A" /gene_synonym="TRAPPC6B" /inference="alignment:Splign:2.1.0" ORIGIN
ggctcccggcggcggcgggccgttgccgtgacggcgggggggcggggggacgcccgcagcgcagcggacatggcggacgaggcgctgttcctgctgctgcacaacgagatggtggcggggctgtaccgcgccgccgagcagggcgaaggggagaacggccgctgcaccaccaagctggagagcatgggcttccgcgtcgggcaggggctgatcgaaaggtttacaaaagatacagccaggttcaaggatgaattagatattatgaagttcatttgcaaagatttttggacaactgtattcaaaaaacaaatagacaacctaaggactaatcatcagggtatttatgttcttcaagacaacaaatttcgactcttgacacaaatgtctgcaggaaagcagtatttagaacatgcaccaaagtatttagcatttacctgtggactaatcagagggggcctatcgaatttgggaataaagagtattgtaacagctgaagtttcatcaatgcctgcatgtaaattccaggtgatgatacagaaaatgtagagcacgttcagatctgggtatccaccttaaacatcctttgtctgtggttttggaatcatggttcagctttgtatatagcatgtaaattatagcactgtgcagcacaattccaaagtatataataaatgtttgttaaaataacactgttctcctatcttggtatgaaattaattctatacaaaggtattaatgtccgtcatggtaaaaactgtcttctcaaaagttaccaacaaaagatttatagtactaaatcaaacaataggtagattttaagaacagagtaaggtcacaacgaagactcagttggtataaggaacaaatgtgttttgtgtcacctaagaaatgccaaactgctgcccttccataaccattccttacagtgaggcagcaactttctattattctgaggaagaaattattgcataactcaacagtcttaattaacagcattcagtggaatatagaactgatatgagcagataaagataacttatttctacaaaaataaaggtatatcctatgcctct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]