GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-16 06:59:10, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001163245            1257 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus glutathione peroxidase 7 (GPX7), mRNA.
ACCESSION   NM_001163245 XM_422477
VERSION     NM_001163245.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1257)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1257)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1257)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000239.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001163245.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: HAEK01171462.1, HAEL01000190.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-214               JAENSK010000239.1  13388428-13388641
            215-476             JAENSK010000239.1  13394161-13394422
            477-1257            JAENSK010000239.1  13396241-13397021
FEATURES             Location/Qualifiers
     source          1..1257
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="8"
                     /map="8"
     gene            1..1257
                     /gene="GPX7"
                     /note="glutathione peroxidase 7"
                     /db_xref="CGNC:8075"
                     /db_xref="GeneID:424643"
     exon            1..214
                     /gene="GPX7"
                     /inference="alignment:Splign:2.1.0"
     CDS             8..640
                     /gene="GPX7"
                     /EC_number="1.11.1.9"
                     /codon_start=1
                     /product="glutathione peroxidase 7"
                     /protein_id="NP_001156717.1"
                     /db_xref="CGNC:8075"
                     /db_xref="GeneID:424643"
                     /translation="
MLDPEGSVEHKPSSSFPKVFLIPLAMLLAITALLLLAFSATQQKETDFYTFKVVNIRGKLVSLEKYRGSVSLVVNVASECGFTDSHYKALQQLQKDLGPYHFNVLAFPCNQFGQQEPDTNKEIESFARKTYGASFPMFSKVAVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVKAWDSTVSVEEIRPHVTELVRKIILKKKDEL"
     misc_feature    146..604
                     /gene="GPX7"
                     /note="The thioredoxin (TRX)-like superfamily is a large,
                     diverse group of proteins containing a TRX fold. Many
                     members contain a classic TRX domain with a redox active
                     CXXC motif. They function as protein disulfide
                     oxidoreductases (PDOs), altering the redox...; Region:
                     Protein Disulfide Oxidoreductases and Other Proteins with
                     a Thioredoxin fold; cl00388"
                     /db_xref="CDD:469754"
     misc_feature    order(245..247,350..352,500..502)
                     /gene="GPX7"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238207"
     misc_feature    order(347..349,356..358,362..364,371..373,380..382,
                     392..394)
                     /gene="GPX7"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238207"
     exon            215..476
                     /gene="GPX7"
                     /inference="alignment:Splign:2.1.0"
     exon            477..1257
                     /gene="GPX7"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gtgcagcatgctagatcctgagggcagtgtggagcacaagccttcctcttccttccctaaagtttttctcattcctctagccatgctccttgcaattacagcactcctgctcttagcattttccgctactcagcagaaagagactgatttttacacttttaaagttgtaaacatcaggggcaaactagtatctctggagaaatacaggggctcggtgtcgttagttgtcaacgttgcaagtgagtgtgggtttacagatagtcactacaaggccttacaacagttacagaaagatcttggcccatatcatttcaatgtgctggcattcccatgcaatcagtttgggcagcaagaaccagacaccaacaaagaaatagagagttttgcacgaaagacttatggtgcctcctttcctatgttcagcaaagttgcggtcagtggagctggtgcaattcctgccttcaagtacttaattgattctactggagaagaaccaacctggaacttctggaaatacttagtagaccccaatgggaaagtagtaaaggcctgggactctactgtctctgttgaagaaataagacctcatgttacagaacttgtaaggaaaatcatcctgaagaaaaaagatgaactgtgactttcaaaaatcatagcaggtcaattacatctttattgataattaggacagggctttgtcttttcacattccaaaagagaatatgcagaagggaaaacatgaccagcagaactgatattcaccaccttcagaatgcagaaaacaaatttaaattttaattactttttaatttaatttttgctatctccacatggagatatttggcccttccaagaaagaagacctcatcagcaactttttaattgccaactcaaattattttttgtttataacactacagaaagctggttaatgtacctctagcaaagaggctcagagtaacaagaatttcccagttgggatcttcccaacatctaaaattctgttgtcatattttgatcacaacctaaatgaaaaaaaaaaagcataaaaagtgtgtgattgatttaaggcatgtgctaggaagaaggcaaaaacagatacctccagtccaaaccaactttactgtatgtttttctagttatgaaggtcaaacatcttatttcatctacctggaaagtcagttaagggcctgaggaaaacatatccatagaacttaaaagaaacagaataaaagtctctgtaaaaactctctaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]