2025-10-17 18:53:19, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001163245 1257 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus glutathione peroxidase 7 (GPX7), mRNA. ACCESSION NM_001163245 XM_422477 VERSION NM_001163245.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1257) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1257) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1257) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000239.1. On Sep 23, 2021 this sequence version replaced NM_001163245.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: HAEK01171462.1, HAEL01000190.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-214 JAENSK010000239.1 13388428-13388641 215-476 JAENSK010000239.1 13394161-13394422 477-1257 JAENSK010000239.1 13396241-13397021 FEATURES Location/Qualifiers source 1..1257 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="8" /map="8" gene 1..1257 /gene="GPX7" /note="glutathione peroxidase 7" /db_xref="CGNC:8075" /db_xref="GeneID:424643" exon 1..214 /gene="GPX7" /inference="alignment:Splign:2.1.0" CDS 8..640 /gene="GPX7" /EC_number="1.11.1.9" /codon_start=1 /product="glutathione peroxidase 7" /protein_id="NP_001156717.1" /db_xref="CGNC:8075" /db_xref="GeneID:424643" /translation="
MLDPEGSVEHKPSSSFPKVFLIPLAMLLAITALLLLAFSATQQKETDFYTFKVVNIRGKLVSLEKYRGSVSLVVNVASECGFTDSHYKALQQLQKDLGPYHFNVLAFPCNQFGQQEPDTNKEIESFARKTYGASFPMFSKVAVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVKAWDSTVSVEEIRPHVTELVRKIILKKKDEL"
misc_feature 146..604 /gene="GPX7" /note="The thioredoxin (TRX)-like superfamily is a large, diverse group of proteins containing a TRX fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox...; Region: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; cl00388" /db_xref="CDD:469754" misc_feature order(245..247,350..352,500..502) /gene="GPX7" /note="catalytic residues [active]" /db_xref="CDD:238207" misc_feature order(347..349,356..358,362..364,371..373,380..382, 392..394) /gene="GPX7" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:238207" exon 215..476 /gene="GPX7" /inference="alignment:Splign:2.1.0" exon 477..1257 /gene="GPX7" /inference="alignment:Splign:2.1.0" ORIGIN
gtgcagcatgctagatcctgagggcagtgtggagcacaagccttcctcttccttccctaaagtttttctcattcctctagccatgctccttgcaattacagcactcctgctcttagcattttccgctactcagcagaaagagactgatttttacacttttaaagttgtaaacatcaggggcaaactagtatctctggagaaatacaggggctcggtgtcgttagttgtcaacgttgcaagtgagtgtgggtttacagatagtcactacaaggccttacaacagttacagaaagatcttggcccatatcatttcaatgtgctggcattcccatgcaatcagtttgggcagcaagaaccagacaccaacaaagaaatagagagttttgcacgaaagacttatggtgcctcctttcctatgttcagcaaagttgcggtcagtggagctggtgcaattcctgccttcaagtacttaattgattctactggagaagaaccaacctggaacttctggaaatacttagtagaccccaatgggaaagtagtaaaggcctgggactctactgtctctgttgaagaaataagacctcatgttacagaacttgtaaggaaaatcatcctgaagaaaaaagatgaactgtgactttcaaaaatcatagcaggtcaattacatctttattgataattaggacagggctttgtcttttcacattccaaaagagaatatgcagaagggaaaacatgaccagcagaactgatattcaccaccttcagaatgcagaaaacaaatttaaattttaattactttttaatttaatttttgctatctccacatggagatatttggcccttccaagaaagaagacctcatcagcaactttttaattgccaactcaaattattttttgtttataacactacagaaagctggttaatgtacctctagcaaagaggctcagagtaacaagaatttcccagttgggatcttcccaacatctaaaattctgttgtcatattttgatcacaacctaaatgaaaaaaaaaaagcataaaaagtgtgtgattgatttaaggcatgtgctaggaagaaggcaaaaacagatacctccagtccaaaccaactttactgtatgtttttctagttatgaaggtcaaacatcttatttcatctacctggaaagtcagttaagggcctgaggaaaacatatccatagaacttaaaagaaacagaataaaagtctctgtaaaaactctctaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]