GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-03 22:18:33, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       NM_001030346            1772 bp    mRNA    linear   VRT 08-APR-2024
DEFINITION  Gallus gallus homeobox A4 (HOXA4), mRNA.
ACCESSION   NM_001030346 XM_418728
VERSION     NM_001030346.3
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1772)
  AUTHORS   Tang,H., Finn,R.D. and Thomas,P.D.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1772)
  AUTHORS   Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
            Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1772)
  AUTHORS   Scotting,P.J., Hewitt,M. and Keynes,R.J.
  TITLE     Isolation and analysis of chick homeobox cDNA clones
  JOURNAL   Nucleic Acids Res 18 (13), 3999 (1990)
   PUBMED   1973835
REFERENCE   4  (bases 1 to 1772)
  AUTHORS   Sasaki,H., Yokoyama,E. and Kuroiwa,A.
  TITLE     Specific DNA binding of the two chicken Deformed family homeodomain
            proteins, Chox-1.4 and Chox-a
  JOURNAL   Nucleic Acids Res 18 (7), 1739-1747 (1990)
   PUBMED   1970866
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000037.1.
            
            On Sep 23, 2021 this sequence version replaced NM_001030346.2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X52670.1, SRR12888538.40123.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992432, SAMEA103992453
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-613               JAENSK010000037.1  1541354-1541966     c
            614-1772            JAENSK010000037.1  1539702-1540860     c
FEATURES             Location/Qualifiers
     source          1..1772
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="2"
                     /map="2"
     gene            1..1772
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /note="homeobox A4"
                     /db_xref="CGNC:49256"
                     /db_xref="GeneID:395307"
     exon            1..613
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /inference="alignment:Splign:2.1.0"
     CDS             16..945
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /note="homeobox protein Hox-1.4"
                     /codon_start=1
                     /product="homeobox protein Hox-A4"
                     /protein_id="NP_001025517.1"
                     /db_xref="CGNC:49256"
                     /db_xref="GeneID:395307"
                     /translation="
MTMSSFLINSNYIEPKFPPCEEYTQHSGSAGSSASYHPHHPHPHAPPPPPPPPPPHLHAAHPGPALPEYFPRPRREPGYQAPAAPPGPPGPPPEALYPAQAPSYPQAPYSYSSAGSAAPGPEQPPPGASPPPPPPAKGHPGPAQPLLPGHALQRRCEAAPAAGAGTGPGCALLPDKSLPGLKGKEPVVYPWMKKIHVSTVNPNYSGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNQPSLGQQQAKAQTQGHPRPLDGAAPNAAAL"
     misc_feature    64..459
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /note="propagated from UniProtKB/Swiss-Prot (P17277.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    577..594
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /note="propagated from UniProtKB/Swiss-Prot (P17277.1);
                     Region: Antp-type hexapeptide"
     misc_feature    643..813
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    814..942
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /note="propagated from UniProtKB/Swiss-Prot (P17277.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            614..1772
                     /gene="HOXA4"
                     /gene_synonym="chox-1.4; HOX1.4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcacttcacaaattaatgaccatgagttcgtttttgataaactccaactacatcgagcccaaattccctccctgcgaggagtacacgcagcacagcggcagcgccggcagctccgccagctaccacccgcaccacccgcacccgcacgccccaccaccgccgccgccgccgccgccgccgcacctgcacgccgcgcacccgggccccgctctgcccgagtacttcccgcggccccgccgggaacccggctaccaggctcccgccgcgccgccggggccgccggggccgcctcccgaggcgctgtacccggcgcaggcaccctcctacccccaggctccctacagctacagcagcgccggcagcgccgccccgggccccgagcagccgcccccgggcgcctctccgccgccgccgccgccggccaagggccaccccgggccggcccagcccctgctccccggccatgccctgcagcgccgctgcgaagcggcccccgccgccggggccggcaccgggccgggctgcgcgttgctgcccgacaagagcctgcccgggctgaaggggaaggagccggtggtgtacccctggatgaagaagatccacgtgagcacggtcaaccccaactacagcggcggggagcccaagcggtcccgcaccgcctacacccgacagcaggtcctggagctggagaaggagttccacttcaaccgctacctgaccaggaggcgacgcatcgagatcgcgcacaccctgtgcctctccgagcgccaggtcaagatctggttccagaaccggcgcatgaagtggaagaaggaccacaagctgcccaacaccaagatgcgctcctccaaccagccctcgctcggccagcagcaggccaaggcacagacacagggccacccccgcccgctcgacggggctgcgcccaacgcggccgcgctataaggggctcgttgttcttgttttttttttttaatatatagatctctatttacctatctattggggttgtgcggccgcccgcgctggcggctggcccttgggaccacgcaactgtgtaagacaaagcaggagcagggaaggaaggacgagacgtgcccagggacgggcacacgttgaaaccaaaacccggacgattgcctacattgtatatagataatggttccatgcccgtcattttttttctatttatggaaaccctctcttgccctcgctgtaagagtgctggatgctgtcacggacgaattctccgtacctatgacggaccctttttttttgttgttgttgttgtcgttgtttttaaacagagaacactttacaaactaaaagacggttcaaacaaagccaggagctcggggggacgcccggtcgaggcggtgactcgagtggcgtgggccgagcgtggccgtgaggggcacacacggacccacgaggcacagagcggacacgttcacctcgggttaaaaactcatgggaagcgtcccctcacgccgtgttggtgtaccggccgtaacttagctgggtttcggtgtagccccgcagtagctgtgatatatgagtttttttcctccacattccccgtcgcatttatttaaaaagaaaagaataataataataacgctattaaaggctgtggctgttttcatatttggcaccgtctaaatcgtttgggtccatgtacaatttgtggattttttggtgtaatgtatacagtgccagatgctggtaataaagattattctgtacaaaaagaattaaacgcttgaaacaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]