ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-09 06:31:00, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001006388 1185 bp mRNA linear VRT 26-JUN-2025
DEFINITION Gallus gallus mitochondrial ribosomal protein L15 (MRPL15), mRNA.
ACCESSION NM_001006388 XM_419204
VERSION NM_001006388.2
KEYWORDS RefSeq.
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
REFERENCE 1 (bases 1 to 1185)
AUTHORS Tang,H., Finn,R.D. and Thomas,P.D.
TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with
Gene Ontology terms and other annotations
JOURNAL Bioinformatics 35 (3), 518-520 (2019)
PUBMED 30032202
REFERENCE 2 (bases 1 to 1185)
AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C.,
Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S.
TITLE Manual GO annotation of predictive protein signatures: the InterPro
approach to GO curation
JOURNAL Database (Oxford) 2012, bar068 (2012)
PUBMED 22301074
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1185)
AUTHORS Caldwell,R.B., Kierzek,A.M., Arakawa,H., Bezzubov,Y., Zaim,J.,
Fiedler,P., Kutter,S., Blagodatski,A., Kostovska,D., Koter,M.,
Plachy,J., Carninci,P., Hayashizaki,Y. and Buerstedde,J.M.
TITLE Full-length cDNAs from chicken bursal lymphocytes to facilitate
gene function analysis
JOURNAL Genome Biol 6 (1), R6 (2005)
PUBMED 15642098
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from
JAENSK010000043.1.
On Sep 23, 2021 this sequence version replaced NM_001006388.1.
##Evidence-Data-START##
Transcript exon combination :: AJ719996.1, CO635611.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA103992290, SAMEA103992323
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: inferred from homology
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-165 JAENSK010000043.1 12955894-12956058
166-323 JAENSK010000043.1 12959247-12959404
324-489 JAENSK010000043.1 12961647-12961812
490-613 JAENSK010000043.1 12962290-12962413
614-1185 JAENSK010000043.1 12963761-12964332
FEATURES Location/Qualifiers
source 1..1185
/organism="Gallus gallus"
/mol_type="mRNA"
/db_xref="taxon:9031"
/chromosome="2"
/map="2"
gene 1..1185
/gene="MRPL15"
/note="mitochondrial ribosomal protein L15"
/db_xref="CGNC:11375"
/db_xref="GeneID:421121"
exon 1..165
/gene="MRPL15"
/inference="alignment:Splign:2.1.0"
CDS 58..951
/gene="MRPL15"
/EC_number="3.6.5.3"
/note="39S ribosomal protein L15, mitochondrial; L15mt;
MRP-L15; large ribosomal subunit protein uL15m"
/codon_start=1
/product="large ribosomal subunit protein uL15m precursor"
/protein_id="NP_001006388.2"
/db_xref="CGNC:11375"
/db_xref="GeneID:421121"
/translation="
MSGNGVHGVHGALQLLRSLPKVSLANLRPNPGSKKPERRRGRGRYRGRKCGRGHKGERQRGNRPRLGFEGGQTPFYLSIPKYGFNEGHSCRRQYHPLSLQKLQYLIDLGRVDPTQPIDLTQLTNARGVTVQPLKRDYGVQLVEEGADIFAAKINIEVQRASELAIAAIEKNGGVVTTSFYDPRSLEILIRPVPFFLRGQPIPKRMLPPEDLVRYYTDASNRGYLADPSKVAEARLELAKKYGYTLPDITKDELFKMLSTRKDPRQIFFGLAPGWIVNMADKKILKPTDERLLKYYSS"
transit_peptide 58..120
/gene="MRPL15"
/note="Mitochondrion.
/evidence=ECO:0000250|UniProtKB:Q0VC21; propagated from
UniProtKB/Swiss-Prot (Q5ZKT8.1)"
mat_peptide 121..948
/gene="MRPL15"
/product="Large ribosomal subunit protein uL15m.
/id=PRO_0000257841"
/note="propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1)"
misc_feature 124..264
/gene="MRPL15"
/note="propagated from UniProtKB/Swiss-Prot (Q5ZKT8.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 217..585
/gene="MRPL15"
/note="Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A;
Region: Ribosomal_L27A; pfam00828"
/db_xref="CDD:459951"
exon 166..323
/gene="MRPL15"
/inference="alignment:Splign:2.1.0"
exon 324..489
/gene="MRPL15"
/inference="alignment:Splign:2.1.0"
exon 490..613
/gene="MRPL15"
/inference="alignment:Splign:2.1.0"
exon 614..1185
/gene="MRPL15"
/inference="alignment:Splign:2.1.0"
ORIGIN
gccgtaaagcagctctgcctgcggagcgctgtcgtcgtccttgggagggcagtggcgatgagcgggaatggtgtgcacggcgtgcatggggctctgcaactgctgcggtcgctgcctaaggtcagcctggccaacctgaggcccaatccgggttcaaaaaagccggagagaagacgtggccgtggacgatacagaggtagaaagtgtggtcgaggtcacaaaggggaaagacaaagaggaaatcgcccccgcttaggctttgaaggtggccaaactccattttatttgtctataccaaaatacgggtttaatgagggacatagctgccgacgtcagtatcatccactcagtcttcagaagctgcagtacctgattgatttgggtagagttgaccctacgcaaccaattgacttaacacagcttactaatgctagaggtgtaacagtacaacctctcaaacgggattatggtgtccagctggtggaggagggtgctgatatctttgcagcaaaaataaatattgaagtgcagagggcgtccgaattagcaattgcagctatagaaaaaaatggcggtgttgttacgacatcgttctatgatccaaggagtttggagattttaattaggccagtcccgttttttctgcgtggccagcctattccaaagcgaatgcttccccctgaagacctagtacgttactacacagatgccagtaatcgtgggtacctggcagatccatctaaggttgcagaagccagacttgaacttgccaagaagtacggatataccttaccagacataactaaggatgagctcttcaaaatgttaagtacgcgcaaagaccctaggcagatattttttggtcttgctccaggatggatcgtaaacatggcagacaagaaaattctgaagccaactgatgagaggctgctaaaatactatagctcgtgaattcaggactggagacaactgcaggtgtacaggaaacatctggatatgaaataatggatacaaagtggtgtttgttttttttaagactcctgttataccagacaaaacagaagtttttgtttatgtaatctactggtgtcgcttttgctgtttttgattgtcataatactgcgtatgaaaaatgttaacagttggaagcagtgtggagtctgaaataaagcatgtatttgggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]