ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-04-25 04:01:46, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_073921731 786 bp mRNA linear VRT 12-MAY-2025 DEFINITION PREDICTED: Danio rerio claudin 1 (cldn1), transcript variant X1, mRNA. ACCESSION XM_073921731 VERSION XM_073921731.1 DBLINK BioProject: PRJNA1248012 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_133177) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_049306965.1-RS_2025_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/11/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..786 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /isolation_source="Zebrafish international resource center" /db_xref="taxon:7955" /chromosome="2" /sex="male" /tissue_type="Fibroblasts and whole tissue" /dev_stage="adult" /ecotype="United States" /geo_loc_name="USA" /collection_date="2022-07-19" /collected_by="National Human Genome Research Institute" /genotype="Double heterozygous" gene 1..786 /gene="cldn1" /gene_synonym="cldn19" /note="claudin 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 long SRA reads, 4 Proteins" /db_xref="GeneID:81590" /db_xref="ZFIN:ZDB-GENE-010328-11" misc_feature 1 /gene="cldn1" /gene_synonym="cldn19" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 43..459 /gene="cldn1" /gene_synonym="cldn19" /codon_start=1 /product="claudin-1 isoform X1" /protein_id="XP_073777832.1" /db_xref="GeneID:81590" /db_xref="ZFIN:ZDB-GENE-010328-11" /translation="
MAHAGLQMLGYCLGFLGLLGLIASTAMAEWKMSSYAGDNIITAQAQYEGLWQSCVSQSTGQLQCKKYDSLLKLPGEIQGARGLMLTGIFLCGLSTLVSFVGMKCTTCLSEAPQAFCSDRHQLVRREDPAEVLRPVYSN"
misc_feature 112..>369
/gene="cldn1"
/gene_synonym="cldn19"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
polyA_site 786
/gene="cldn1"
/gene_synonym="cldn19"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
agtgttcagtgttctctcagttcctcctccagctctctcctgatggcgcacgcagggctgcagatgctgggttactgtctgggttttctgggtctgctgggtctgatcgcctccacagccatggcggagtggaagatgtcctcgtacgccggagacaacatcatcacagcacaggcgcagtatgagggactgtggcagtcctgtgtgtcgcagagcaccggccagctgcagtgcaaaaaatacgactccctgctgaagctgccaggggagatccagggggctcgagggctgatgctgaccggcatcttcctgtgtggcctgtcgacgctggtgtctttcgtgggcatgaagtgcacaacctgcctttcagaagcgccacaggctttttgctctgatcgccaccagctggtacggagagaagatccggcagaagttcttcgacccgtttactccaactaacgcgaggtatgagttcgggaaggctctgtatgtgggctggggctcttcagctctctccatcatcggcggttccctgctctgctgtatctgtgggagtgaagcttctgaaaaaccctcgtatcctccagcgcgcgcagcaggacgcccgggaactgaccgcgtctgaacacacacctgactacagacaaacctgcgcctgtgtgtgtgtgtgtttgtgtgtgtgtgtgtgtgtgtttaatcttcgcctgtttcctgattaaccctctgcactgatgtaaatgaccggctcatcatgacgcactcattaaagctgaagtgtgtgtgtta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]