2025-09-13 21:10:11, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_073914792 627 bp mRNA linear VRT 12-MAY-2025 DEFINITION PREDICTED: Danio rerio large ribosomal subunit protein uL6-like (LOC798685), mRNA. ACCESSION XM_073914792 VERSION XM_073914792.1 DBLINK BioProject: PRJNA1248012 KEYWORDS RefSeq; corrected model. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_133185) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_049306965.1-RS_2025_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/11/2025 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 2 indels internal stop codons :: corrected 5 genomic stop codons ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-164 JBMGRA010000010.1 30890293-30890456 165-275 JBMGRA010000010.1 30890458-30890568 276-277 "NN" 1-2 278-627 JBMGRA010000010.1 30890569-30890918 FEATURES Location/Qualifiers source 1..627 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /isolation_source="Zebrafish international resource center" /db_xref="taxon:7955" /chromosome="10" /sex="male" /tissue_type="Fibroblasts and whole tissue" /dev_stage="adult" /ecotype="United States" /geo_loc_name="USA" /collection_date="2022-07-19" /collected_by="National Human Genome Research Institute" /genotype="Double heterozygous" gene 1..627 /gene="LOC798685" /note="large ribosomal subunit protein uL6-like; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon; deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:798685" misc_feature 1 /gene="LOC798685" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 12..590 /gene="LOC798685" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon; deleted 1 base in 1 codon; substituted 5 bases at 5 genomic stop codons" /codon_start=1 /transl_except=(pos:93..95,aa:OTHER) /transl_except=(pos:120..122,aa:OTHER) /transl_except=(pos:462..464,aa:OTHER) /transl_except=(pos:492..494,aa:OTHER) /transl_except=(pos:525..527,aa:OTHER) /product="LOW QUALITY PROTEIN: large ribosomal subunit protein uL6-like" /protein_id="XP_073770893.1" /db_xref="GeneID:798685" /translation="
MKTILSKQTVDTPDNVMLSLKGRTVTIXGPSTVLYQXFNHINLELSLLGKKRKKLRVDKWWVKRKELATVRSICSHVQNMIKGVNLGFXKILSVYDHFPINVVIQESGSLMEIRNFLGEKCIHHVRMRQGVVCAVSATQKDELVLEDNYMXLVSNSTALIXQATTVRKKDIXKFLDGIYVSEKGTVVEQQED"
ORIGIN
aatctgcgagaatgaagaccattctcagtaagcagacagtggacaccccagacaatgtcatgctgtccctcaagggccgcacagttaccatttagggacccagtactgttctctaccagtagttcaaccacattaacctggaactcagtctgttgggcaagaaaagaaaaaagctgcgtgtggataagtggtgggttaaaagaaaagagttggccacagtccgcagcatctgcagtcatgtccagaacatgatcaagggggtcaacctgggctttnncaaaatactatctgtatatgaccattttcccattaatgtggtcatccaagagtctggctcactgatggagatcagaaacttcttgggagagaagtgcatccaccatgtccgcatgaggcaaggagttgtgtgtgcagtgtctgccactcaaaaagatgagttggttttggaggataattacatgtagctggtatcaaactcaactgctctgatctagcaggccaccactgtgagaaagaaagacatctgaaagttcctggatgggatttatgtcagcgagaagggcacagtggtggaacagcaagaggactaaattagtctctgtaaaatctgtcaataaagacaattcc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]