2025-07-01 07:09:14, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_005170906 665 bp mRNA linear VRT 08-SEP-2024 DEFINITION PREDICTED: Danio rerio ribosomal protein L9 (rpl9), transcript variant X1, mRNA. ACCESSION XM_005170906 VERSION XM_005170906.5 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007112.7) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 8, 2024 this sequence version replaced XM_005170906.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000002035.6-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/15/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="1" gene 1..665 /gene="rpl9" /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01; zgc:103730" /note="ribosomal protein L9; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 66 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 156 samples with support for all annotated introns" /db_xref="GeneID:336702" /db_xref="ZFIN:ZDB-GENE-030131-8646" misc_feature 1 /gene="rpl9" /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01; zgc:103730" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 34..615 /gene="rpl9" /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01; zgc:103730" /codon_start=1 /product="large ribosomal subunit protein uL6 isoform X1" /protein_id="XP_005170963.1" /db_xref="GeneID:336702" /db_xref="ZFIN:ZDB-GENE-030131-8646" /translation="
MKTILSNQTVDIPDNVTVSLKGRTVTVKGPRGVLRREFNHINLELSLLGKKQKKLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQESGSLVEIRNFLGEKYIRRVRMRQGVACAVSAAQKDELVLEGNDIELVSNSAALIQQATTVRKKDIRKFLDGIYVSEKGTVVEQQED"
misc_feature 34..600 /gene="rpl9" /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01; zgc:103730" /note="60S ribosomal protein L6; Provisional; Region: PTZ00027" /db_xref="CDD:240234" polyA_site 665 /gene="rpl9" /gene_synonym="ab02c03; fa93a01; mg:ab02c03; wu:fa93a01; zgc:103730" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
cttcctccttcctttcccccttaatcggcgagaatgaagaccattctcagtaaccagacagtggacatccctgacaatgtcacggtgtccctcaagggccgcacagttaccgtgaagggaccccgtggtgttctccgccgggagttcaaccacattaacctggaactcagtctgttgggcaaaaaacagaaaaagctgcgtgtggataagtggtggggtaacagaaaggagttggccaccgtccgcaccatctgcagtcatgtccagaacatgatcaagggtgtcaccctgggcttcaggtacaaaatgcgatctgtatatgcccattttcccattaatgtggtcatccaagagtctggctctctggtggagatcagaaacttcttgggagagaagtacatccgccgtgtccgcatgaggcaaggagttgcatgtgcagtgtctgccgctcaaaaagacgagttggttctggagggtaatgatattgagctggtgtcaaactcagctgctctgatccagcaggccaccactgtgaggaagaaggacatccggaagttcctggatgggatttatgtcagcgagaagggcacagtggtggaacagcaagaggactaaattagtctctgtaaaatctgtcaataaagaccaactccatttttcaatca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]